IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ T cells down-regulate macrophage TNF production by IRAK1-mediated IL-10 expression and control innate hyperinflammation. T cells down-regulate macrophage TNF production by IRAK1-mediated IL-10 expression and control innate hyperinflammation. Proceedings of the National Academy of Sciences of the United States of America 2014 imex curation Inoue M., Arikawa T., Chen YH., Moriwaki Y., Price M., Brown M., Perfect JR., Shinohara ML., Inoue M., Arikawa T., Chen YH., Moriwaki Y., Price M., Brown M., Perfect JR., Shinohara ML. IBD - Inflammatory bowel disease mari.shinohara@duke.edu 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-macrophage Mus musculus macrophage macrophage Macrophage confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Inoue M., Arikawa T., Chen YH., Moriwaki Y., Price M., Brown M., Perfect JR., Shinohara ML., Inoue M., Arikawa T., Chen YH., Moriwaki Y., Price M., Brown M., Perfect JR., Shinohara ML. IBD - Inflammatory bowel disease Supp fig 6 - Splenic macrophages Cells were treated with LPS or LPS and anti-CD40. mari.shinohara@duke.edu Accepted 2015-DEC-15 AT 10:17 GMT AT 10:17 GMT by ORCHARD Proceedings of the National Academy of Sciences of the United States of America 2014 Only protein-protein interactions imex curation imex curation I have moved EBI-11327613 from Expt-3 to here, and altered role. (-Fig 4B is a Western Blot only -so I assume you meant Fig 6B.) T cells down-regulate macrophage TNF production by IRAK1-mediated IL-10 expression and control innate hyperinflammation. T cells down-regulate macrophage TNF production by IRAK1-mediated IL-10 expression and control innate hyperinflammation. Proceedings of the National Academy of Sciences of the United States of America 2014 imex curation Inoue M., Arikawa T., Chen YH., Moriwaki Y., Price M., Brown M., Perfect JR., Shinohara ML., Inoue M., Arikawa T., Chen YH., Moriwaki Y., Price M., Brown M., Perfect JR., Shinohara ML. IBD - Inflammatory bowel disease mari.shinohara@duke.edu 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-macrophage Mus musculus macrophage macrophage Macrophage anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Inoue M., Arikawa T., Chen YH., Moriwaki Y., Price M., Brown M., Perfect JR., Shinohara ML., Inoue M., Arikawa T., Chen YH., Moriwaki Y., Price M., Brown M., Perfect JR., Shinohara ML. IBD - Inflammatory bowel disease Bone marrow (BM)-derived macrophage or peritoneal macrophages mari.shinohara@duke.edu Accepted 2015-DEC-15 AT 10:17 GMT AT 10:17 GMT by ORCHARD Proceedings of the National Academy of Sciences of the United States of America 2014 Only protein-protein interactions imex curation imex curation I have moved EBI-11327613 from Expt-3 to here, and altered role. (-Fig 4B is a Western Blot only -so I assume you meant Fig 6B.) T cells down-regulate macrophage TNF production by IRAK1-mediated IL-10 expression and control innate hyperinflammation. T cells down-regulate macrophage TNF production by IRAK1-mediated IL-10 expression and control innate hyperinflammation. Proceedings of the National Academy of Sciences of the United States of America 2014 imex curation Inoue M., Arikawa T., Chen YH., Moriwaki Y., Price M., Brown M., Perfect JR., Shinohara ML., Inoue M., Arikawa T., Chen YH., Moriwaki Y., Price M., Brown M., Perfect JR., Shinohara ML. IBD - Inflammatory bowel disease mari.shinohara@duke.edu 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-macrophage Mus musculus macrophage macrophage Macrophage ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Inoue M., Arikawa T., Chen YH., Moriwaki Y., Price M., Brown M., Perfect JR., Shinohara ML., Inoue M., Arikawa T., Chen YH., Moriwaki Y., Price M., Brown M., Perfect JR., Shinohara ML. IBD - Inflammatory bowel disease Peritoneal macrophages treated with LPS and CD40 antibody. mari.shinohara@duke.edu Accepted 2015-DEC-15 AT 10:17 GMT AT 10:17 GMT by ORCHARD Proceedings of the National Academy of Sciences of the United States of America 2014 Only protein-protein interactions imex curation imex curation I have moved EBI-11327613 from Expt-3 to here, and altered role. (-Fig 4B is a Western Blot only -so I assume you meant Fig 6B.) il10_mouse_gene Interleukin-10 gene gene gene mouse Mus musculus Mouse irak1_mouse Interleukin-1 receptor-associated kinase 1 Pelle-like protein kinase Irak1 Il1rak protein protein mouse Mus musculus Mouse MAGGPGPGEPVVPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSEQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPVVPPSTAAPRPSSISAGSEAGDWSPRKLQSSASTFLSPAFPGSQTHSESELLQVPLPVSLGPPLPSSAPSSTKSSPESPVSGLQRAHPSPFCWPFCEISQGTCNFSEELRIGEGGFGCVYRAVMRNTTYAVKRLKEEADLEWTMVKQSFLTEVEQLSRFRHPNIVDFAGYCAESGLYCLVYGFLPNGSLEDQLHLQTQACSPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLMPKLGDFGLARFSRFAGAKASQSSTVARTSTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVILETLAGQRAVRTQGAKTKYLKDLIEDEAEEAGVTLKSTQPTLWVGVATDAWAAPIAAQIYKKHLDSRPGPCPPQLGLALAQLACCCMHRRAKKRPPMTQVYKRLEGLQAGPPWELEVAGHGSPSPQENSYMSTTGSAQSGDEPWQPLVVTTRAPAQAAQQLQRSPNQPVESDESVPGLSATLHSWHLTPGSHPSPASFREASCTQGGTTRESSVRSSPGFQPTTMEGSPTGSSSLLSSEPPQIIINPARQKMVQKLALYEEGVLDSLQLLSSGFFPGLDLEPEKSQGPEESDEFQS DIP protein Q62406 original sequence version: 122 DIP protein Q62406 original sequence version: 98 8A501F002CD3EBD2 ostp_mouse Osteopontin Spp1 Eta-1 Op Spp-1 2AR Bone sialoprotein 1 Calcium oxalate crystal growth inhibitor protein Early T-lymphocyte activation 1 protein Minopontin Secreted phosphoprotein 1 protein protein mouse Mus musculus Mouse MRLAVICFCLFGIASSLPVKVTDSGSSEEKLYSLHPDPIATWLVPDPSQKQNLLAPQNAVSSEEKDDFKQETLPSNSNESHDHMDDDDDDDDDDGDHAESEDSVDSDESDESHHSDESDETVTASTQADTFTPIVPTVDVPNGRGDSLAYGLRSKSRSFQVSDEQYPDATDEDLTSHMKSGESKESLDVIPVAQLLSMPSDQDNNGKGSHESSQLDEPSLETHRLEHSKESQESADQSDVIDSQASSKASLEHQSHKFHSHKDKLVLDPKSKEDDRYLKFRISHELESSSSEVN 9D5F32D67ABC53EA traf2_mouse TNF receptor-associated factor 2 Traf2 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein mouse Mus musculus Mouse MAAASVTSPGSLELLQPGFSKTLLGTRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL DIP protein P39429 original sequence version: 90 DIP protein P39429 original sequence version: 130 DIP protein P39429 original sequence version: 135 DIP protein P39429 original sequence version: 166 043B391180365F10 irf5_mouse Interferon regulatory factor 5 Irf5 protein protein mouse Mus musculus Mouse MNHSAPGIPPPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFYIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFQLFYDGPRDMPPQPYKIYEVCSNGPAPTESQPTDDYVLGEEEEEEEEELQRMLPGLSITEPALPGPPNAPYSLPKEDTKWPPALQPPVGLGPPVPDPNLLAPPSGNPAGFRQLLPEVLEPGPLASSQPPTEPLLPDLLISPHMLPLTDLEIKFQYRGRAPRTLTISNPQGCRLFYSQLEATQEQVELFGPVTLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCALAHGSCPNPIQREVKTKLFSLEQFLNELILFQKGQTNTPPPFEIFFCFGEEWPDVKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDHMVEQFKELHHLWQSQQQLQPMVQAPPVAGLDASQGPWPMHPVGMQ DIP protein P56477 original sequence version: 107 D8BD54DB946E354F irak1-il10_mouse_gene-1 3 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 4C Q62406 increases the expression at protein level of ENSMUSG00000016529 causality form figs 4D, S4 P18893 decreases the expression at the RNA level of ENSMUSG00000024401 irak1-irf5-1 2 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 4F, 5D LPS plus CD40 antibody LPS Traf2 shRNA irak1-irf5-2 1 8 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component colocalization colocalization 4G, Supp Fig 6 LPS alone (Supp fig 6) or LPS plus CD40 antibody irak1-traf2-1 2 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 5A LPS plus CD40 antibody irak1-spp1-1 1 6 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component colocalization colocalization 6A LPS plus CD40 antibody Opn-i - an intracellular isoform of OPN with a deletion of the N-terminal 16-aa signal sequence, is stated to have been detected, but the antibody used (sc-21742) would not appear to distinguish between isoforms. irak1-spp1-2 2 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 6B LPS plus CD40 antibody irak1-traf2-2 2 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 6A, 6D LPS plus CD40 antibody OPN knockout.