IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A Crohn's disease variant in Atg16l1 enhances its degradation by caspase 3. A Crohn's disease variant in Atg16l1 enhances its degradation by caspase 3. Nature (0028-0836) 2014 imex curation Murthy A., Li Y., Peng I., Reichelt M., Katakam A.K., Noubade R., Roose-Girma M., DeVoss J., Diehl L., Graham R.R., van Lookeren Campagne M. Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease IBD - Inflammatory bowel disease menno@gene.com 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-macrophage Mus musculus macrophage macrophage Macrophage fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Murthy A., Li Y., Peng I., Reichelt M., Katakam A.K., Noubade R., Roose-Girma M., DeVoss J., Diehl L., Graham R.R., van Lookeren Campagne M. Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease menno@gene.com Accepted 2014-DEC-18 by ORCHARD Nature (0028-0836) 2014 Only protein-protein interactions imex curation A Crohn's disease variant in Atg16l1 enhances its degradation by caspase 3. A Crohn's disease variant in Atg16l1 enhances its degradation by caspase 3. Nature (0028-0836) 2014 imex curation Murthy A., Li Y., Peng I., Reichelt M., Katakam A.K., Noubade R., Roose-Girma M., DeVoss J., Diehl L., Graham R.R., van Lookeren Campagne M. Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease IBD - Inflammatory bowel disease menno@gene.com 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protease assay protease assay anti tag western anti tag western blot anti tag western Murthy A., Li Y., Peng I., Reichelt M., Katakam A.K., Noubade R., Roose-Girma M., DeVoss J., Diehl L., Graham R.R., van Lookeren Campagne M. Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease Processing of the thr300ala ATG16L1beta variant by caspase-1 and caspae-6 occured with lower efficiency compared to caspase-3. The expression system of recombinant human active caspases was obtained from the supplier's website (MBL International). menno@gene.com Accepted 2014-DEC-18 by ORCHARD Nature (0028-0836) 2014 Only protein-protein interactions imex curation a16l1_mouse Autophagy-related protein 16-1 APG16-like 1 Atg16l1 Apg16l protein protein mouse Mus musculus Mouse MSSGLRAADFPRWKRHIAEELRRRDRLQRQAFEEIILQYTKLLEKSDLHSVLTQKLQAEKHDMPNRHEISPGHDGAWNDSQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQQKDKEIQMNEAKISEYLQTISDLETNCLDLRTKLQDLEVANQTLKDEYDALQITFTALEEKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAVSRAATKRLSQPAGGLLDSITNIFGRRSVSSIPVPQDIMDTHPASGKDVRVPTTASYVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEAFGDKCEFKGSLSGSNAGITSIEFDSAGAYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESVVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAVKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYVWSVLTGKVEKVLSKQHSSSINAVAWAPSGLHVVSVDKGSRAVLWAQP DIP protein Q8C0J2 original sequence version: 51 DIP protein Q8C0J2 original sequence version: 91 DIP protein Q8C0J2 original sequence version: 97 DIP protein Q8C0J2-1 original sequence version: 104 63920320883A69DF mlp3a_mouse Microtubule-associated proteins 1A/1B light chain 3A Map1lc3a Autophagy-related protein LC3 A Autophagy-related ubiquitin-like modifier LC3 A MAP1 light chain 3-like protein 1 MAP1A/MAP1B light chain 3 A Microtubule-associated protein 1 light chain 3 alpha protein protein mouse Mus musculus Mouse MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF 48C1FBE8F7892AF3 casp3_human Caspase-3 Apopain Cysteine protease CPP32 Protein Yama SREBP cleavage activity 1 CASP3 CPP32 protein protein human Homo sapiens Human MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH DIP protein P42574 original sequence version: 108 DIP protein P42574 original sequence version: 171 DIP protein P42574 original sequence version: 111 DIP protein P42574 original sequence version: 105 DIP protein P42574 original sequence version: 131 DIP protein P42574 original sequence version: 132 DIP protein P42574 original sequence version: 134 DIP protein P42574 original sequence version: 162 DIP protein P42574 original sequence version: 189 DIP protein P42574 original sequence version: 167 2F35CD3BCF7FF64A a16l1_human Autophagy-related protein 16-1 APG16-like 1 UNQ9393/PRO34307 ATG16L1 APG16L protein protein human Homo sapiens Human MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY DIP protein Q676U5 original sequence version: 96 5A5816AE2CF03CA0 casp1_human Caspase-1 Interleukin-1 beta convertase Interleukin-1 beta-converting enzyme p45 CASP1 IL1BC IL1BCE protein protein human Homo sapiens Human MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH DIP protein P29466 original sequence version: 155 DIP protein P29466-1 original sequence version: 169 DIP protein P29466 original sequence version: 169 DIP protein P29466 original sequence version: 163 DIP protein P29466 original sequence version: 101 DIP protein P29466 original sequence version: 160 DIP protein P29466 original sequence version: 184 ABF33CF33CC71584 casp6_human Caspase-6 Apoptotic protease Mch-2 CASP6 MCH2 protein protein human Homo sapiens Human MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN DIP protein P55212 original sequence version: 118 0738AE4F9791EBD7 atg16l1-casp3 2 5 enzyme enzyme neutral component neutral component ecolx Escherichia coli 6 enzyme target enzyme target substrate substrate neutral component neutral component Q676U5:p.Thr300Ala mutation increasing rate mutation increasing interaction rate mutation increasing rate mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Wed May 02 16:30:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr300ala' Tue Jun 30 19:57:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr300Ala' c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q676U5:p.Asp299Glu mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D E Wed May 02 17:04:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp299glu' Tue Jun 30 17:00:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp299Glu' in vitro In vitro protein cleavage protein cleavage Fig. 1b, Extended data fig. 1a P42574 is required for cleavage of Q676U5 P42574 increases degradation at protein level of Q676U5 atg16l1-map1lc3a 1 4 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component Q8C0J2:p.Thr300Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Wed May 02 18:14:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr300ala' Tue Jun 30 19:18:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr300Ala' colocalization colocalization Fig. 3a atg16l1-casp1 2 6 enzyme target enzyme target substrate substrate neutral component neutral component Q676U5:p.Thr300Ala mutation increasing rate mutation increasing interaction rate mutation increasing rate mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Wed May 02 16:01:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr300ala' Tue Jun 30 17:06:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr300Ala' c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro 7 enzyme enzyme neutral component neutral component ecolx Escherichia coli protein cleavage protein cleavage Extended data fig. 1a P29466 is required for cleavage of Q676U5 atg16l1-casp6 2 8 enzyme enzyme neutral component neutral component ecolx Escherichia coli 6 enzyme target enzyme target substrate substrate neutral component neutral component c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q676U5:p.Thr300Ala mutation increasing rate mutation increasing interaction rate mutation increasing rate mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:27:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr300ala' Tue Jun 30 18:15:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr300Ala' in vitro In vitro protein cleavage protein cleavage Extended data fig. 1a P55212 is required for cleavage of Q676U5