IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The ubiquitin ligase Stub1 negatively modulates regulatory T cell suppressive activity by promoting degradation of the transcription factor Foxp3. The ubiquitin ligase Stub1 negatively modulates regulatory T cell suppressive activity by promoting degradation of the transcription factor Foxp3. Immunity 2013 imex curation Chen Z., Barbi J., Bu S., Yang HY., Li Z., Gao Y., Jinasena D., Fu J., Lin F., Chen C., Zhang J., Yu N., Li X., Shan Z., Nie J., Gao Z., Tian H., Li Y., Yao Z., Zheng Y., Park BV., Pan Z., Zhang J., Dang E., Li Z., Wang H., Luo W., Li L., Semenza GL., Zheng SG., Loser K., Tsun A., Greene MI., Pardoll DM., Pan F., Li B. IBD - Inflammatory bowel disease The quoted UniProt Accession No: P08107 for Human "HSP70" is from an obsolete entry. fpan1@jhmi.edu,binli@sibs.ac.cn 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen Z., Barbi J., Bu S., Yang HY., Li Z., Gao Y., Jinasena D., Fu J., Lin F., Chen C., Zhang J., Yu N., Li X., Shan Z., Nie J., Gao Z., Tian H., Li Y., Yao Z., Zheng Y., Park BV., Pan Z., Zhang J., Dang E., Li Z., Wang H., Luo W., Li L., Semenza GL., Zheng SG., Loser K., Tsun A., Greene MI., Pardoll DM., Pan F., Li B. IBD - Inflammatory bowel disease The quoted UniProt Accession No: P08107 for Human "HSP70" is from an obsolete entry. fpan1@jhmi.edu,binli@sibs.ac.cn Accepted 2016-JUL-11 AT 13:26 BST AT 13:26 BST by ORCHARD Immunity 2013 Only protein-protein interactions imex curation imex curation For Mouse Hsp70 a "created" protein cannot be used as a Bait - so I have added a comment, as no antibody in the world would distinguish the two proteins (- the only other option is to delete the interaction, or have two baits...); I have added P0DMV9 to some existing Causality statements, and added a couple of new ones; (although in this instance, a statement of the type "P0DMV8 OR P0DMV9 is required for the ubiquitination of Q9BZS1 by Q9UNE7" + other similar statements - but this format is not on the list of "approved" statements.; I have created a "new" protein - short label "hsp70_human" with a "no-uniport-update" XRef - used throughout apart from the mouse experiment. I hope this is what you meant. The ubiquitin ligase Stub1 negatively modulates regulatory T cell suppressive activity by promoting degradation of the transcription factor Foxp3. The ubiquitin ligase Stub1 negatively modulates regulatory T cell suppressive activity by promoting degradation of the transcription factor Foxp3. Immunity 2013 imex curation Chen Z., Barbi J., Bu S., Yang HY., Li Z., Gao Y., Jinasena D., Fu J., Lin F., Chen C., Zhang J., Yu N., Li X., Shan Z., Nie J., Gao Z., Tian H., Li Y., Yao Z., Zheng Y., Park BV., Pan Z., Zhang J., Dang E., Li Z., Wang H., Luo W., Li L., Semenza GL., Zheng SG., Loser K., Tsun A., Greene MI., Pardoll DM., Pan F., Li B. IBD - Inflammatory bowel disease The quoted UniProt Accession No: P08107 for Human "HSP70" is from an obsolete entry. fpan1@jhmi.edu,binli@sibs.ac.cn 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen Z., Barbi J., Bu S., Yang HY., Li Z., Gao Y., Jinasena D., Fu J., Lin F., Chen C., Zhang J., Yu N., Li X., Shan Z., Nie J., Gao Z., Tian H., Li Y., Yao Z., Zheng Y., Park BV., Pan Z., Zhang J., Dang E., Li Z., Wang H., Luo W., Li L., Semenza GL., Zheng SG., Loser K., Tsun A., Greene MI., Pardoll DM., Pan F., Li B. IBD - Inflammatory bowel disease The quoted UniProt Accession No: P08107 for Human "HSP70" is from an obsolete entry. fpan1@jhmi.edu,binli@sibs.ac.cn Accepted 2016-JUL-11 AT 13:26 BST AT 13:26 BST by ORCHARD Immunity 2013 Only protein-protein interactions imex curation imex curation For Mouse Hsp70 a "created" protein cannot be used as a Bait - so I have added a comment, as no antibody in the world would distinguish the two proteins (- the only other option is to delete the interaction, or have two baits...); I have added P0DMV9 to some existing Causality statements, and added a couple of new ones; (although in this instance, a statement of the type "P0DMV8 OR P0DMV9 is required for the ubiquitination of Q9BZS1 by Q9UNE7" + other similar statements - but this format is not on the list of "approved" statements.; I have created a "new" protein - short label "hsp70_human" with a "no-uniport-update" XRef - used throughout apart from the mouse experiment. I hope this is what you meant. The ubiquitin ligase Stub1 negatively modulates regulatory T cell suppressive activity by promoting degradation of the transcription factor Foxp3. The ubiquitin ligase Stub1 negatively modulates regulatory T cell suppressive activity by promoting degradation of the transcription factor Foxp3. Immunity 2013 imex curation Chen Z., Barbi J., Bu S., Yang HY., Li Z., Gao Y., Jinasena D., Fu J., Lin F., Chen C., Zhang J., Yu N., Li X., Shan Z., Nie J., Gao Z., Tian H., Li Y., Yao Z., Zheng Y., Park BV., Pan Z., Zhang J., Dang E., Li Z., Wang H., Luo W., Li L., Semenza GL., Zheng SG., Loser K., Tsun A., Greene MI., Pardoll DM., Pan F., Li B. IBD - Inflammatory bowel disease The quoted UniProt Accession No: P08107 for Human "HSP70" is from an obsolete entry. fpan1@jhmi.edu,binli@sibs.ac.cn 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro ubiquitinase assay ubiquitinase assay ubiquitinase assay anti tag western anti tag western blot anti tag western Chen Z., Barbi J., Bu S., Yang HY., Li Z., Gao Y., Jinasena D., Fu J., Lin F., Chen C., Zhang J., Yu N., Li X., Shan Z., Nie J., Gao Z., Tian H., Li Y., Yao Z., Zheng Y., Park BV., Pan Z., Zhang J., Dang E., Li Z., Wang H., Luo W., Li L., Semenza GL., Zheng SG., Loser K., Tsun A., Greene MI., Pardoll DM., Pan F., Li B. IBD - Inflammatory bowel disease The quoted UniProt Accession No: P08107 for Human "HSP70" is from an obsolete entry. fpan1@jhmi.edu,binli@sibs.ac.cn Accepted 2016-JUL-11 AT 13:26 BST AT 13:26 BST by ORCHARD Immunity 2013 Only protein-protein interactions imex curation imex curation For Mouse Hsp70 a "created" protein cannot be used as a Bait - so I have added a comment, as no antibody in the world would distinguish the two proteins (- the only other option is to delete the interaction, or have two baits...); I have added P0DMV9 to some existing Causality statements, and added a couple of new ones; (although in this instance, a statement of the type "P0DMV8 OR P0DMV9 is required for the ubiquitination of Q9BZS1 by Q9UNE7" + other similar statements - but this format is not on the list of "approved" statements.; I have created a "new" protein - short label "hsp70_human" with a "no-uniport-update" XRef - used throughout apart from the mouse experiment. I hope this is what you meant. The ubiquitin ligase Stub1 negatively modulates regulatory T cell suppressive activity by promoting degradation of the transcription factor Foxp3. The ubiquitin ligase Stub1 negatively modulates regulatory T cell suppressive activity by promoting degradation of the transcription factor Foxp3. Immunity 2013 imex curation Chen Z., Barbi J., Bu S., Yang HY., Li Z., Gao Y., Jinasena D., Fu J., Lin F., Chen C., Zhang J., Yu N., Li X., Shan Z., Nie J., Gao Z., Tian H., Li Y., Yao Z., Zheng Y., Park BV., Pan Z., Zhang J., Dang E., Li Z., Wang H., Luo W., Li L., Semenza GL., Zheng SG., Loser K., Tsun A., Greene MI., Pardoll DM., Pan F., Li B. IBD - Inflammatory bowel disease The quoted UniProt Accession No: P08107 for Human "HSP70" is from an obsolete entry. fpan1@jhmi.edu,binli@sibs.ac.cn 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-jurkat Homo sapiens jurkat Human T cell leukemia confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Chen Z., Barbi J., Bu S., Yang HY., Li Z., Gao Y., Jinasena D., Fu J., Lin F., Chen C., Zhang J., Yu N., Li X., Shan Z., Nie J., Gao Z., Tian H., Li Y., Yao Z., Zheng Y., Park BV., Pan Z., Zhang J., Dang E., Li Z., Wang H., Luo W., Li L., Semenza GL., Zheng SG., Loser K., Tsun A., Greene MI., Pardoll DM., Pan F., Li B. IBD - Inflammatory bowel disease Cells were treated with LPS and MG132 (to preserve FoxP3) The quoted UniProt Accession No: P08107 for Human "HSP70" is from an obsolete entry. fpan1@jhmi.edu,binli@sibs.ac.cn Accepted 2016-JUL-11 AT 13:26 BST AT 13:26 BST by ORCHARD Immunity 2013 Only protein-protein interactions imex curation imex curation For Mouse Hsp70 a "created" protein cannot be used as a Bait - so I have added a comment, as no antibody in the world would distinguish the two proteins (- the only other option is to delete the interaction, or have two baits...); I have added P0DMV9 to some existing Causality statements, and added a couple of new ones; (although in this instance, a statement of the type "P0DMV8 OR P0DMV9 is required for the ubiquitination of Q9BZS1 by Q9UNE7" + other similar statements - but this format is not on the list of "approved" statements.; I have created a "new" protein - short label "hsp70_human" with a "no-uniport-update" XRef - used throughout apart from the mouse experiment. I hope this is what you meant. The ubiquitin ligase Stub1 negatively modulates regulatory T cell suppressive activity by promoting degradation of the transcription factor Foxp3. The ubiquitin ligase Stub1 negatively modulates regulatory T cell suppressive activity by promoting degradation of the transcription factor Foxp3. Immunity 2013 imex curation Chen Z., Barbi J., Bu S., Yang HY., Li Z., Gao Y., Jinasena D., Fu J., Lin F., Chen C., Zhang J., Yu N., Li X., Shan Z., Nie J., Gao Z., Tian H., Li Y., Yao Z., Zheng Y., Park BV., Pan Z., Zhang J., Dang E., Li Z., Wang H., Luo W., Li L., Semenza GL., Zheng SG., Loser K., Tsun A., Greene MI., Pardoll DM., Pan F., Li B. IBD - Inflammatory bowel disease The quoted UniProt Accession No: P08107 for Human "HSP70" is from an obsolete entry. fpan1@jhmi.edu,binli@sibs.ac.cn 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chen Z., Barbi J., Bu S., Yang HY., Li Z., Gao Y., Jinasena D., Fu J., Lin F., Chen C., Zhang J., Yu N., Li X., Shan Z., Nie J., Gao Z., Tian H., Li Y., Yao Z., Zheng Y., Park BV., Pan Z., Zhang J., Dang E., Li Z., Wang H., Luo W., Li L., Semenza GL., Zheng SG., Loser K., Tsun A., Greene MI., Pardoll DM., Pan F., Li B. IBD - Inflammatory bowel disease The quoted UniProt Accession No: P08107 for Human "HSP70" is from an obsolete entry. fpan1@jhmi.edu,binli@sibs.ac.cn Accepted 2016-JUL-11 AT 13:26 BST AT 13:26 BST by ORCHARD Immunity 2013 Only protein-protein interactions imex curation imex curation For Mouse Hsp70 a "created" protein cannot be used as a Bait - so I have added a comment, as no antibody in the world would distinguish the two proteins (- the only other option is to delete the interaction, or have two baits...); I have added P0DMV9 to some existing Causality statements, and added a couple of new ones; (although in this instance, a statement of the type "P0DMV8 OR P0DMV9 is required for the ubiquitination of Q9BZS1 by Q9UNE7" + other similar statements - but this format is not on the list of "approved" statements.; I have created a "new" protein - short label "hsp70_human" with a "no-uniport-update" XRef - used throughout apart from the mouse experiment. I hope this is what you meant. The ubiquitin ligase Stub1 negatively modulates regulatory T cell suppressive activity by promoting degradation of the transcription factor Foxp3. The ubiquitin ligase Stub1 negatively modulates regulatory T cell suppressive activity by promoting degradation of the transcription factor Foxp3. Immunity 2013 imex curation Chen Z., Barbi J., Bu S., Yang HY., Li Z., Gao Y., Jinasena D., Fu J., Lin F., Chen C., Zhang J., Yu N., Li X., Shan Z., Nie J., Gao Z., Tian H., Li Y., Yao Z., Zheng Y., Park BV., Pan Z., Zhang J., Dang E., Li Z., Wang H., Luo W., Li L., Semenza GL., Zheng SG., Loser K., Tsun A., Greene MI., Pardoll DM., Pan F., Li B. IBD - Inflammatory bowel disease The quoted UniProt Accession No: P08107 for Human "HSP70" is from an obsolete entry. fpan1@jhmi.edu,binli@sibs.ac.cn 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen Z., Barbi J., Bu S., Yang HY., Li Z., Gao Y., Jinasena D., Fu J., Lin F., Chen C., Zhang J., Yu N., Li X., Shan Z., Nie J., Gao Z., Tian H., Li Y., Yao Z., Zheng Y., Park BV., Pan Z., Zhang J., Dang E., Li Z., Wang H., Luo W., Li L., Semenza GL., Zheng SG., Loser K., Tsun A., Greene MI., Pardoll DM., Pan F., Li B. IBD - Inflammatory bowel disease The quoted UniProt Accession No: P08107 for Human "HSP70" is from an obsolete entry. fpan1@jhmi.edu,binli@sibs.ac.cn Accepted 2016-JUL-11 AT 13:26 BST AT 13:26 BST by ORCHARD Immunity 2013 Only protein-protein interactions imex curation imex curation For Mouse Hsp70 a "created" protein cannot be used as a Bait - so I have added a comment, as no antibody in the world would distinguish the two proteins (- the only other option is to delete the interaction, or have two baits...); I have added P0DMV9 to some existing Causality statements, and added a couple of new ones; (although in this instance, a statement of the type "P0DMV8 OR P0DMV9 is required for the ubiquitination of Q9BZS1 by Q9UNE7" + other similar statements - but this format is not on the list of "approved" statements.; I have created a "new" protein - short label "hsp70_human" with a "no-uniport-update" XRef - used throughout apart from the mouse experiment. I hope this is what you meant. The ubiquitin ligase Stub1 negatively modulates regulatory T cell suppressive activity by promoting degradation of the transcription factor Foxp3. The ubiquitin ligase Stub1 negatively modulates regulatory T cell suppressive activity by promoting degradation of the transcription factor Foxp3. Immunity 2013 imex curation Chen Z., Barbi J., Bu S., Yang HY., Li Z., Gao Y., Jinasena D., Fu J., Lin F., Chen C., Zhang J., Yu N., Li X., Shan Z., Nie J., Gao Z., Tian H., Li Y., Yao Z., Zheng Y., Park BV., Pan Z., Zhang J., Dang E., Li Z., Wang H., Luo W., Li L., Semenza GL., Zheng SG., Loser K., Tsun A., Greene MI., Pardoll DM., Pan F., Li B. IBD - Inflammatory bowel disease The quoted UniProt Accession No: P08107 for Human "HSP70" is from an obsolete entry. fpan1@jhmi.edu,binli@sibs.ac.cn 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Chen Z., Barbi J., Bu S., Yang HY., Li Z., Gao Y., Jinasena D., Fu J., Lin F., Chen C., Zhang J., Yu N., Li X., Shan Z., Nie J., Gao Z., Tian H., Li Y., Yao Z., Zheng Y., Park BV., Pan Z., Zhang J., Dang E., Li Z., Wang H., Luo W., Li L., Semenza GL., Zheng SG., Loser K., Tsun A., Greene MI., Pardoll DM., Pan F., Li B. IBD - Inflammatory bowel disease The quoted UniProt Accession No: P08107 for Human "HSP70" is from an obsolete entry. fpan1@jhmi.edu,binli@sibs.ac.cn Accepted 2016-JUL-11 AT 13:26 BST AT 13:26 BST by ORCHARD Immunity 2013 Only protein-protein interactions imex curation imex curation For Mouse Hsp70 a "created" protein cannot be used as a Bait - so I have added a comment, as no antibody in the world would distinguish the two proteins (- the only other option is to delete the interaction, or have two baits...); I have added P0DMV9 to some existing Causality statements, and added a couple of new ones; (although in this instance, a statement of the type "P0DMV8 OR P0DMV9 is required for the ubiquitination of Q9BZS1 by Q9UNE7" + other similar statements - but this format is not on the list of "approved" statements.; I have created a "new" protein - short label "hsp70_human" with a "no-uniport-update" XRef - used throughout apart from the mouse experiment. I hope this is what you meant. ub2d2_human Ubiquitin-conjugating enzyme E2 D2 UBC5B UBCH4 UBE2D2 UBC4 UBCH5B Ubiquitin-protein ligase D2 Ubiquitin carrier protein D2 Ubiquitin-conjugating enzyme E2-17 kDa 2 Ubiquitin-conjugating enzyme E2(17)KB 2 PUBC1 p53-regulated ubiquitin-conjugating enzyme 1 (E3-independent) E2 ubiquitin-conjugating enzyme D2 E2 ubiquitin-conjugating enzyme D2 protein protein human Homo sapiens Human MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM DIP protein P62837 original sequence version: 81 DIP protein P62837-1 original sequence version: 134 DIP protein P62837 original sequence version: 95 DIP protein P62837 original sequence version: 139 DIP protein P62837 original sequence version: 37 DIP protein P62837 original sequence version: 115 DIP protein P62837 original sequence version: 58 DIP protein P62837 original sequence version: 74 DIP protein P62837 original sequence version: 103 DIP protein P62837 original sequence version: 101 C942BE7853CBC355 chip_human E3 ubiquitin-protein ligase CHIP CHIP STUB1 PP1131 Carboxy terminus of Hsp70-interacting protein STIP1 homology and U box-containing protein 1 CLL-associated antigen KW-8 Antigen NY-CO-7 RING-type E3 ubiquitin transferase CHIP protein protein human Homo sapiens Human MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY 7E7D6568B17070BF uba1_human Ubiquitin-like modifier-activating enzyme 1 Ubiquitin-activating enzyme E1 Protein A1S9 UBA1 A1S9T UBE1 protein protein human Homo sapiens Human MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNTPLEDQLRVGEFCHNRGIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARHGFESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKKISFKSLVASLAEPDFVVTDFAKFSRPAQLHIGFQALHQFCAQHGRPPRPRNEEDAAELVALAQAVNARALPAVQQNNLDEDLIRKLAYVAAGDLAPINAFIGGLAAQEVMKACSGKFMPIMQWLYFDALECLPEDKEVLTEDKCLQRQNRYDGQVAVFGSDLQEKLGKQKYFLVGAGAIGCELLKNFAMIGLGCGEGGEIIVTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMNPHIRVTSHQNRVGPDTERIYDDDFFQNLDGVANALDNVDARMYMDRRCVYYRKPLLESGTLGTKGNVQVVIPFLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDEFEGLFKQPAENVNQYLTDPKFVERTLRLAGTQPLEVLEAVQRSLVLQRPQTWADCVTWACHHWHTQYSNNIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNPLHLDYVMAAANLFAQTYGLTGSQDRAAVATFLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLPGFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPSADRHKSKLIAGKIIPAIATTTAAVVGLVCLELYKVVQGHRQLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRYTIR DIP protein P22314 original sequence version: 157 DIP protein P22314 original sequence version: 152 4B413AAA75FAA562 hspa1a_hspa1b_human-1 HSPA1A_HSPA1B_human molecule set molecule set human Homo sapiens Human MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD P0DMV8,P0DMV9 hs71a_mouse Heat shock 70 kDa protein 1A Hspa1a Heat shock 70 kDa protein 3 Hsp68 Hsp70-3 Hsp70A1 protein protein mouse Mus musculus Mouse MAKNTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDAVVQSDMKHWPFQVVNDGDKPKVQVNYKGESRSFFPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRGTLEPVEKALRDAKMDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEVQRDRVAAKNALESYAFNMKSAVEDEGLKGKLSEADKKKVLDKCQEVISWLDSNTLADKEEFVHKREELERVCSPIISGLYQGAGAPGAGGFGAQAPKGASGSGPTIEEVD F49C33E602EAE334 hsp7c_human Heat shock cognate 71 kDa protein HSPA8 HSC70 HSP73 HSPA10 Heat shock 70 kDa protein 8 Lipopolysaccharide-associated protein 1 protein protein human Homo sapiens Human MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD 9AA27B210730670C foxp3_mouse Forkhead box protein P3 Foxp3 Scurfin protein protein mouse Mus musculus Mouse MPNPRPAKPMAPSLALGPSPGVLPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPPSQLQLPTVPLVMVAPSGARLGPSPHLQALLQDRPHFMHQLSTVDAHAQTPVLQVRPLDNPAMISLPPPSAATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPRSGTPRKDSNLLAAPQGSYPLLANGVCKWPGCEKVFEEPEEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKEKLGAMQAHLAGKMALAKAPSVASMDKSSCCIVATSTQGSVLPAWSAPREAPDGGLFAVRRHLWGSHGNSSFPEFFHNMDYFKYHNMRPPFTYATLIRWAILEAPERQRTLNEIYHWFTRMFAYFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDEFEFRKKRSQRPNKCSNPCP DIP protein Q99JB6 original sequence version: 120 DIP protein Q99JB6 original sequence version: 110 DIP protein Q99JB6 original sequence version: 114 DIP protein Q99JB6 original sequence version: 102 DIP protein Q99JB6 original sequence version: 100 28D5B8E67891840C hs71b_mouse Heat shock 70 kDa protein 1B Hspa1b Hcp70.1 Hsp70-1 Hsp70a1 Heat shock 70 kDa protein 1 Hspa1 protein protein mouse Mus musculus Mouse MAKNTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDAVVQSDMKHWPFQVVNDGDKPKVQVNYKGESRSFFPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRGTLEPVEKALRDAKMDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEVQRDRVAAKNALESYAFNMKSAVEDEGLKGKLSEADKKKVLDKCQEVISWLDSNTLADKEEFVHKREELERVCSPIISGLYQGAGAPGAGGFGAQAPPKGASGSGPTIEEVD DIP protein P17879 original sequence version: 93 4BB9B0B130C23D8B foxp3_human Forkhead box protein P3 Scurfin FOXP3 IPEX JM2 protein protein human Homo sapiens Human MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQLQLPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQRPSRCSNPTPGP DIP protein Q9BZS1 original sequence version: 139 DIP protein Q9BZS1 original sequence version: 131 91737C3CEA665A15 foxp3-stub1-1 1 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1G foxp3-stub1-2 2 9 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association 1H foxp3-stub1-3 2 9 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association 1Hi 34r3r-1 7 11 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp Figure 1 E/F foxp3-stub1-4 1 9 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1G, 3B, Supp 1 K/L Foxp3 mutants retained their ability to interact with Stub1. foxp3-stub1-5 1 11 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association 4A foxp3-hspa1a-1 1 11 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 4Ai The STUB1 K30A mutant did not interact. foxp3-hspa1a-2 6 14 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey physical association physical association 4B foxp3-hspa1a-3 6 15 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association 4Bi HSPA1B (UniProt) P17879 may be the Bait as well as HSPA1A- these proteins differ by one amino acid near the C-terminus. foxp3-stub1-6 3 11 ancillary ancillary neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 ancillary ancillary neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 ancillary ancillary neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 enzyme enzyme neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 16 enzyme target enzyme target substrate substrate neutral component neutral component region ubiquitinylated lysine ubiquitinylated lysine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) ubiquitination ubiquitination reaction ubiquitination 4E I have not added Ubiq as an interactor - as it is added as a PTM. Sandra said it was OK to add Causality statements derived from cell lines here (to an In Vitro Expt). CHEBI:16412 decreases expression at protein level of Q9BZS1 CHEBI:75142 causes no change to expression at protein level of Q9BZS1 CHEBI:16412 increases expression at protein level of Q9UNE7 Q9UNE7 increases the ubiquitination of Q9BZS1 P0DMV8 is required for the ubiquitination of Q9BZS1 by Q9UNE7 Q9UNE7 decreases expression at protein level of Q9BZS1 CHEBI:16412 increases expression at RNA level of Q9UNE7 P0DMV8 increases the ubiquitination of Q9BZS1 P0DMV8, P0DMV9 and Q9UNE7 increases degradation at protein level of Q9BZS1. P0DMV9 increases the ubiquitination of Q9BZS1 P0DMV8, P0DMV9 and Q9UNE7 decreases expression at protein level of Q9BZS1 P0DMV9 is required for the ubiquitination of Q9BZS1 by Q9UNE7 foxp3-stub1-7 4 9 unspecified role unspecified role neutral component neutral component 16 unspecified role unspecified role neutral component neutral component n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Supp 1M foxp3-hspa1a-4 5 13 unspecified role unspecified role prey prey 11 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Supp 4