IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The guggulsterone derivative GG-52 inhibits NF-κB signaling in bone marrow-derived dendritic cells and attenuates colitis in IL-10 knockout mice. The guggulsterone derivative GG-52 inhibits NF-κB signaling in bone marrow-derived dendritic cells and attenuates colitis in IL-10 knockout mice. Life sciences 2013 imex curation Kang SJ., Kim JM., Koh SJ., Kim SH., Im JP., Jung HC., Kim JS. IBD - Inflammatory bowel disease sorry - I had not realized there was so little in this publication before I got into doing it jooskim@snu.ac.kr 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Kang SJ., Kim JM., Koh SJ., Kim SH., Im JP., Jung HC., Kim JS. IBD - Inflammatory bowel disease sorry - I had not realized there was so little in this publication before I got into doing it jooskim@snu.ac.kr Accepted 2015-JUL-29 by ORCHARD Life sciences 2013 Only protein-protein interactions imex curation imex curation consensus_nfkb_site_probe NFKB CONSENSUS OLIGONUCLEOTIDE ss dna single stranded deoxyribonucleic acid ss DNA ss dna chemical synthesis Chemical synthesis (Chemical synthesis) AGTTGAGGGGACTTTCCCAGGC p25799-pro_0000030313 Nuclear factor NF-kappa-B p50 subunit Nfkb1 DNA-binding factor KBF1 EBP-1 NF-kappa-B1 p84/NF-kappa-B1 p98 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein mouse Mus musculus Mouse MADDDPYGTGQMFHLNTALTHSIFNAELYSPEIPLSTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGSTGSPGPGYGYSNYGFPPYGGITFHPGVTKSNAGVTHG 0597F8EA07635A94 1 431 0597F8EA07635A94 consensus_nfkb_site_probe-nfkb1-1 1 3 unspecified role unspecified role prey prey mouse-bmdc Mus musculus bone marrow-derived dendritic cells bmdm-1 bone marrow-derived macrophage 2 unspecified role unspecified role bait bait N/A 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2 GG-52 -a guggulsterone derivative