IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Vitamin D receptor activators upregulate and rescue podocalyxin expression in high glucose-treated human podocytes. Vitamin D receptor activators upregulate and rescue podocalyxin expression in high glucose-treated human podocytes. Nephron Exp. Nephrol. (1660-8151) 2012 imex curation Verouti S.N., Tsilibary E.C., Fragopoulou E., Iatrou C., Demopoulos C.A., Charonis A.S., Charonis S.A., Drossopoulou G.I. IBD - Inflammatory bowel disease Figure 5 shows co-localization of VDR and RXR in the nucleus of HGEC cells, which is further enhanced by calcitriol and paricalcitol. However, due to the use of pan-RXR antibody that recognizes RXR alpha, beta and gamma, the exact identity of the RXR participant in these interactions could not be determined. Hence, this experiment is not captured here. effie@bio.demokritos.gr 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hgec Homo sapiens immortalized human glomerular endothelial cell line hgec immortalized human glomerular endothelial cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Verouti S.N., Tsilibary E.C., Fragopoulou E., Iatrou C., Demopoulos C.A., Charonis A.S., Charonis S.A., Drossopoulou G.I. IBD - Inflammatory bowel disease Figure 5 shows co-localization of VDR and RXR in the nucleus of HGEC cells, which is further enhanced by calcitriol and paricalcitol. However, due to the use of pan-RXR antibody that recognizes RXR alpha, beta and gamma, the exact identity of the RXR participant in these interactions could not be determined. Hence, this experiment is not captured here. effie@bio.demokritos.gr Accepted 2014-NOV-17 by ORCHARD Nephron Exp. Nephrol. (1660-8151) 2012 imex curation med1_human Mediator of RNA polymerase II transcription subunit 1 TRIP2 MED1 ARC205 DRIP205 TRAP220 Activator-recruited cofactor 205 kDa component Mediator complex subunit 1 Peroxisome proliferator-activated receptor-binding protein Thyroid hormone receptor-associated protein complex 220 kDa component Thyroid receptor-interacting protein 2 p53 regulatory protein RB18A Vitamin D receptor-interacting protein complex component DRIP205 CRSP1 CRSP200 DRIP230 PBP PPARBP PPARGBP RB18A protein protein human Homo sapiens Human MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIMYWKATNAGPLDKILHGSVGYLTPRSGGHLMNLKYYVSPSDLLDDKTASPIILHENNVSRSLGMNASVTIEGTSAVYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLPACFFLKFPQPIPVSRAFVQKLQNCTGIPLFETQPTYAPLYELITQFELSKDPDPIPLNHNMRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVKRTILKEDSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGYGMTTGNNPMSGTTTPTNTFPGGPITTLFNMSMSIKDRHESVGHGEDFSKVSQNPILTSLLQITGNGGSTIGSSPTPPHHTPPPVSSMAGNTKNHPMLMNLLKDNPAQDFSTLYGSSPLERQNSSSGSPRMEICSGSNKTKKKKSSRLPPEKPKHQTEDDFQRELFSMDVDSQNPIFDVNMTADTLDTPHITPAPSQCSTPPTTYPQPVPHPQPSIQRMVRLSSSDSIGPDVTDILSDIAEEASKLPSTSDDCPAIGTPLRDSSSSGHSQSTLFDSDVFQTNNNENPYTDPADLIADAAGSPSSDSPTNHFFHDGVDFNPDLLNSQSQSGFGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPFTPPTSTGGSKSPGSAGRSQTPPGVATPPIPKITIQIPKGTVMVGKPSSHSQYTSSGSVSSSGSKSHHSHSSSSSSSASTSGKMKSSKSEGSSSSKLSSSMYSSQGSSGSSQSKNSSQSGGKPGSSPITKHGLSSGSSSTKMKPQGKPSSLMNPSLSKPNISPSHSRPPGGSDKLASPMKPVPGTPPSSKAKSPISSGSGGSHMSGTSSSSGMKSSSGLGSSGSLSQKTPPSSNSCTASSSSFSSSGSSMSSSQNQHGSSKGKSPSRNKKPSLTAVIDKLKHGVVTSGPGGEDPLDGQMGVSTNSSSHPMSSKHNMSGGEFQGKREKSDKDKSKVSTSGSSVDSSKKTSESKNVGSTGVAKIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLPEYSTEKHKKHKKEKKKVKDKDRDRDRDKDRDKKKSHSIKPESWSKSPISSDQSLSMTSNTILSADRPSRLSPDFMIGEEDDDLMDVALIGN DIP protein Q15648 original sequence version: 135 DIP protein Q15648 original sequence version: 149 DIP protein Q15648 original sequence version: 100 DIP protein Q15648-1 original sequence version: 113 FCE0FE87EF08B887 podxl_human_gene Podocalyxin (PODXL) human gene gene gene human Homo sapiens Human h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62805 original sequence version: 68 DIP protein P62805 original sequence version: 111 DIP protein P62805 original sequence version: 94 DIP protein P62805 original sequence version: 97 DIP protein P62805 original sequence version: 116 DIP protein P62805 original sequence version: 105 DIP protein P62805 original sequence version: 120 DIP protein P62805 original sequence version: 144 DIP protein P62805 original sequence version: 150 DIP protein P62805 original sequence version: 154 DIP protein P62805 original sequence version: 156 DIP protein P62805 original sequence version: 112 DIP protein P62805 original sequence version: 121 DIP protein P62805 original sequence version: 123 DIP protein P62805 original sequence version: 126 DIP protein P62805 original sequence version: 132 DIP protein P62805 original sequence version: 136 DIP protein P62805 original sequence version: 119 A9E5DFD3F8B97598 vdr_human Vitamin D3 receptor 1,25-dihydroxyvitamin D3 receptor Nuclear receptor subfamily 1 group I member 1 VDR NR1I1 protein protein human Homo sapiens Human MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVFGNEIS DIP protein P11473 original sequence version: 179 DIP protein P11473 original sequence version: 146 F95F300D042C4CB7 vdr-podxl-1 1 5 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 10b, 10c P11473 increases expression at RNA level of ENSG00000128567 P11473 increases expression at protein level of ENSG00000128567 paricalcitol (CHEBI:7931), an analog of 1,25-dihydroxyergocalciferol, the active form of vitamin D2 med1-podxl-1 1 3 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2 unspecified role unspecified role bait bait association association Fig. 10b, 10c paricalcitol (CHEBI:7931), an analog of 1,25-dihydroxyergocalciferol, the active form of vitamin D2 CHEBI:7931 increases binding of Q15648 to ENSG00000128567 hist1h4a-podxl-1 1 4 unspecified role unspecified role bait bait possible acetyllys-9 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 10b, 10c paricalcitol (CHEBI:7931), an analog of 1,25-dihydroxyergocalciferol, the active form of vitamin D2 CHEBI:7931 increases binding of P62805 to ENSG00000128567