IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ TNF-α-induced down-regulation of CDX2 suppresses MEP1A expression in colitis. TNF-α-induced down-regulation of CDX2 suppresses MEP1A expression in colitis. Biochimica et biophysica acta 2012 imex curation Coskun M., Olsen AK., Holm TL., Kvist PH., Nielsen OH., Riis LB., Olsen J., Troelsen JT. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis IBD - Inflammatory bowel disease mehmet.coskun@regionh.dk 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Coskun M., Olsen AK., Holm TL., Kvist PH., Nielsen OH., Riis LB., Olsen J., Troelsen JT. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis mehmet.coskun@regionh.dk Accepted 2015-JUL-13 by ORCHARD Biochimica et biophysica acta 2012 Only protein-protein interactions imex curation imex curation cdx2_human Homeobox protein CDX-2 CDX2 CDX3 CDX-3 Caudal-type homeobox protein 2 protein protein human Homo sapiens Human MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVPGSVPGVLGPTGGVLNPTVTQ B5724F1F7CA569AF mep1a_human_gene Meprin A subunit alpha MEP1A gene gene human Homo sapiens Human cdx2_human_gene CDX2_HUMAN_GENE gene gene human Homo sapiens Human cdx2-cdx2_human_gene-2 1 4 unspecified role unspecified role prey prey 5-prime and 3-prime regulatory regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2 unspecified role unspecified role bait bait association association 5B TNF-alpha (P01375) P01375 decreases binding of Q99626 to ENSG00000165556 P01375 decreases expression at RNA level of ENSG00000165556 cdx2-mep1a-1 1 3 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2 unspecified role unspecified role bait bait association association 5Bi TNF-alpha (P01375) P01375 decreases binding of Q99626 to ENSG00000112818 Q99626 increases expression at RNA level of ENSG00000112818 P01375 decreases expression at RNA level of ENSG00000112818