IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ cAMP-responsive element modulator (CREM)α protein induces interleukin 17A expression and mediates epigenetic alterations at the interleukin-17A gene locus in patients with systemic lupus erythematosus. cAMP-responsive element modulator (CREM)α protein induces interleukin 17A expression and mediates epigenetic alterations at the interleukin-17A gene locus in patients with systemic lupus erythematosus. J. Biol. Chem. (0021-9258) 2011 imex curation Rauen T., Hedrich C.M., Juang Y.T., Tenbrock K., Tsokos G.C. IBD - Inflammatory bowel disease Interactions in human T cells and SLE T cells between the IL17A gene promoter and histone H3 that were determined by ChIP (Fig. 4) using anti-H3 antibody were not captured here due to lack of antibody specificity. The exact isoform of CREM detected in ChIP experiments cannot be identified; the antibody used (described in PMID:15841182) potentially reacts with ~15 isoforms of human CREM. The human DNMT3a expression construct is described in PMID:21346232. trauen@bidmc.harvard.edu,gtsokos@bidmc.harvard.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Rauen T., Hedrich C.M., Juang Y.T., Tenbrock K., Tsokos G.C. IBD - Inflammatory bowel disease Interactions in human T cells and SLE T cells between the IL17A gene promoter and histone H3 that were determined by ChIP (Fig. 4) using anti-H3 antibody were not captured here due to lack of antibody specificity. Chromatin immunoprecipitation was performed with T cells from healthy individuals and T cells from SLE patients. The exact isoform of CREM detected in ChIP experiments cannot be identified; the antibody used (described in PMID:15841182) potentially reacts with ~15 isoforms of human CREM. The exact isoform of CREM detected in ChIP experiments cannot be identified; the antibody used (described in PMID:15841182) potentially reacts with ~15 isoforms of human CREM. The exact isoform of CREM detected in ChIP experiments cannot be identified; the antibody used (described in PMID:15841182) potentially reacts with ~15 isoforms of human CREM. trauen@bidmc.harvard.edu,gtsokos@bidmc.harvard.edu Accepted 2015-JAN-21 by MGT J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation cAMP-responsive element modulator (CREM)α protein induces interleukin 17A expression and mediates epigenetic alterations at the interleukin-17A gene locus in patients with systemic lupus erythematosus. cAMP-responsive element modulator (CREM)α protein induces interleukin 17A expression and mediates epigenetic alterations at the interleukin-17A gene locus in patients with systemic lupus erythematosus. J. Biol. Chem. (0021-9258) 2011 imex curation Rauen T., Hedrich C.M., Juang Y.T., Tenbrock K., Tsokos G.C. IBD - Inflammatory bowel disease Interactions in human T cells and SLE T cells between the IL17A gene promoter and histone H3 that were determined by ChIP (Fig. 4) using anti-H3 antibody were not captured here due to lack of antibody specificity. The exact isoform of CREM detected in ChIP experiments cannot be identified; the antibody used (described in PMID:15841182) potentially reacts with ~15 isoforms of human CREM. The human DNMT3a expression construct is described in PMID:21346232. trauen@bidmc.harvard.edu,gtsokos@bidmc.harvard.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-t cells cd 4+ Homo sapiens t-cell_cd4+ t cell cd4+ ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Rauen T., Hedrich C.M., Juang Y.T., Tenbrock K., Tsokos G.C. IBD - Inflammatory bowel disease Interactions in human T cells and SLE T cells between the IL17A gene promoter and histone H3 that were determined by ChIP (Fig. 4) using anti-H3 antibody were not captured here due to lack of antibody specificity. Chromatin was immunoprecipitated from both naïve CD4+ T cells and CD4+ T cells activated by incubation in the presence of plate-bound anti-CD3 and anti-CD28 antibodies. The exact isoform of CREM detected in ChIP experiments cannot be identified; the antibody used (described in PMID:15841182) potentially reacts with ~15 isoforms of human CREM. The exact isoform of CREM detected in ChIP experiments cannot be identified; the antibody used (described in PMID:15841182) potentially reacts with ~15 isoforms of human CREM. trauen@bidmc.harvard.edu,gtsokos@bidmc.harvard.edu Accepted 2015-JAN-21 by MGT J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation cAMP-responsive element modulator (CREM)α protein induces interleukin 17A expression and mediates epigenetic alterations at the interleukin-17A gene locus in patients with systemic lupus erythematosus. cAMP-responsive element modulator (CREM)α protein induces interleukin 17A expression and mediates epigenetic alterations at the interleukin-17A gene locus in patients with systemic lupus erythematosus. J. Biol. Chem. (0021-9258) 2011 imex curation Rauen T., Hedrich C.M., Juang Y.T., Tenbrock K., Tsokos G.C. IBD - Inflammatory bowel disease Interactions in human T cells and SLE T cells between the IL17A gene promoter and histone H3 that were determined by ChIP (Fig. 4) using anti-H3 antibody were not captured here due to lack of antibody specificity. The exact isoform of CREM detected in ChIP experiments cannot be identified; the antibody used (described in PMID:15841182) potentially reacts with ~15 isoforms of human CREM. The human DNMT3a expression construct is described in PMID:21346232. trauen@bidmc.harvard.edu,gtsokos@bidmc.harvard.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Rauen T., Hedrich C.M., Juang Y.T., Tenbrock K., Tsokos G.C. IBD - Inflammatory bowel disease Interactions in human T cells and SLE T cells between the IL17A gene promoter and histone H3 that were determined by ChIP (Fig. 4) using anti-H3 antibody were not captured here due to lack of antibody specificity. The exact isoform of CREM detected in ChIP experiments cannot be identified; the antibody used (described in PMID:15841182) potentially reacts with ~15 isoforms of human CREM. trauen@bidmc.harvard.edu,gtsokos@bidmc.harvard.edu Accepted 2015-JAN-21 by MGT J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 il17_human_cre-site_dna-probe Human IL17 gene promoter cAMP-responsive element DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human CACGTAAGTGACCACAGAAGG crem_human cAMP-responsive element modulator CREM Inducible cAMP early repressor protein protein human Homo sapiens Human MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVSVAGSGTRRGSPAVTLVQLPSGQTIHVQGVIQTPQPWVIQSSEIHTVQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAPSHMAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY 4DDEE62904CDD0E6 il17_human_gene Interleukin-17A (IL17A) human gene IL17A CTLA8 IL17 gene gene human Homo sapiens Human dnm3a_human DNA (cytosine-5)-methyltransferase 3A DNMT3A DNA methyltransferase HsaIIIA Cysteine methyltransferase DNMT3A protein protein human Homo sapiens Human MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPVESGDTPKDPAVISKSPSMAQDSGASELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEGAAETLPEASRAVENGCCTPKEGRGAPAEAGKEQKETNIESMKMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAGMNAVEENQGPGESQKVEEASPPAVQQPTDPASPTVATTPEPVGSDAGDKNATKAGDDEPEYEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYNKQPMYRKAIYEVLQVASSRAGKLFPVCHDSDESDTAKAVEVQNKPMIEWALGGFQPSGPKGLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTAEKPKVKEIIDERTRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV DIP protein Q9Y6K1 original sequence version: 134 DIP protein Q9Y6K1-1 original sequence version: 88 DIP protein Q9Y6K1 original sequence version: 88 DIP protein Q9Y6K1-1 original sequence version: 135 BD1FF7C5B4F54A33 crem-il17-1 2 7 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait association association Fig. 2c, 2d The interaction was significantly increased in activated CD4+ T cells. Binding was increased in Th17 helper cells (which express IL17) as compared to Th1 and 2 cells (Fig. 3). anti-CD3 and anti-CD28 antibodies Q03060 increases expression at RNA level of ENSG00000112115 crem-il17-2 1 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 2e, 2f Chromatin immunoprecipitation was performed with T cells from healthy individuals and T cells from SLE patients. A trend was observed towards increased binding in SLE T cells; however, the difference was not statistically significant. hdac1-il17-2 2 7 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait association association Fig. 5a, 5b The interaction was significantly decreased in activated CD4+ T cells. Although the figure legend is titled 'Increased HDAC1 recruitment to the CRE site after T cell activation', both the figure and the main text clearly indicate less HDAC1 binding to this site in activated cells. anti-CD3 and anti-CD28 antibodies hdac1-il17-1 1 7 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait association association Fig. 5c, 5d Chromatin immunoprecipitation was performed with T cells from healthy individuals and T cells from SLE patients. The interaction was significantly decreased in the latter. Although the figure legend is titled 'Increased HDAC1 recruitment to the CRE site in SLE T cells', both the figure and the main text clearly indicate less HDAC1 binding to this site in these cells. dnmt3a-il17-1 1 7 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait association association Fig. 7a, 7b Chromatin immunoprecipitation was performed with T cells from healthy individuals and T cells from SLE patients. The interaction was significantly decreased in the latter. Q9Y6K1 decreases expression at RNA level of ENSG00000112115 il17-crem-1 3 5 unspecified role unspecified role bait bait atp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes physical association physical association Fig. 2a