IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Matrilysin-1 (MMP7) cleaves galectin-3 and inhibits wound healing in intestinal epithelial cells. Matrilysin-1 (MMP7) cleaves galectin-3 and inhibits wound healing in intestinal epithelial cells. Inflammatory bowel diseases 2011 imex curation Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH., Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH. IBD - Inflammatory bowel disease jkwon@medicine.bsd.uchicago.edu 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro cleavage cleavage assay cleavage partial id prot seq partial identification of protein sequence partial id prot seq Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH., Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH. IBD - Inflammatory bowel disease jkwon@medicine.bsd.uchicago.edu Accepted 2016-OCT-18 AT 10:38 BST AT 10:38 BST by PPORRAS Inflammatory bowel diseases 2011 Only protein-protein interactions imex curation imex curation Matrilysin-1 (MMP7) cleaves galectin-3 and inhibits wound healing in intestinal epithelial cells. Matrilysin-1 (MMP7) cleaves galectin-3 and inhibits wound healing in intestinal epithelial cells. Inflammatory bowel diseases 2011 imex curation Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH., Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH. IBD - Inflammatory bowel disease jkwon@medicine.bsd.uchicago.edu 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro cleavage cleavage assay cleavage weight by comassie molecular weight estimation by coomasie staining weight by comassie Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH., Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH. IBD - Inflammatory bowel disease jkwon@medicine.bsd.uchicago.edu Accepted 2016-OCT-18 AT 10:38 BST AT 10:38 BST by PPORRAS Inflammatory bowel diseases 2011 Only protein-protein interactions imex curation imex curation Matrilysin-1 (MMP7) cleaves galectin-3 and inhibits wound healing in intestinal epithelial cells. Matrilysin-1 (MMP7) cleaves galectin-3 and inhibits wound healing in intestinal epithelial cells. Inflammatory bowel diseases 2011 imex curation Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH., Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH. IBD - Inflammatory bowel disease jkwon@medicine.bsd.uchicago.edu 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro cleavage cleavage assay cleavage western blot western blot Immuno blot Immuno blot Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH., Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH. IBD - Inflammatory bowel disease Cleavage reaction products were detected with an anti-galectin-3 C-terminus antibody and an anti-galectin-3 N-terminus antibody. jkwon@medicine.bsd.uchicago.edu Accepted 2016-OCT-18 AT 10:38 BST AT 10:38 BST by PPORRAS Inflammatory bowel diseases 2011 Only protein-protein interactions imex curation imex curation Matrilysin-1 (MMP7) cleaves galectin-3 and inhibits wound healing in intestinal epithelial cells. Matrilysin-1 (MMP7) cleaves galectin-3 and inhibits wound healing in intestinal epithelial cells. Inflammatory bowel diseases 2011 imex curation Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH., Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH. IBD - Inflammatory bowel disease jkwon@medicine.bsd.uchicago.edu 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro cleavage cleavage assay cleavage fingerprinting peptide massfingerprinting fingerprinting Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH., Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH. IBD - Inflammatory bowel disease jkwon@medicine.bsd.uchicago.edu Accepted 2016-OCT-18 AT 10:38 BST AT 10:38 BST by PPORRAS Inflammatory bowel diseases 2011 Only protein-protein interactions imex curation imex curation Matrilysin-1 (MMP7) cleaves galectin-3 and inhibits wound healing in intestinal epithelial cells. Matrilysin-1 (MMP7) cleaves galectin-3 and inhibits wound healing in intestinal epithelial cells. Inflammatory bowel diseases 2011 imex curation Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH., Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH. IBD - Inflammatory bowel disease jkwon@medicine.bsd.uchicago.edu 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-t84 Homo sapiens colon carcinoma t84 human colon carcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH., Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH. IBD - Inflammatory bowel disease Cleavage reaction products were detected with an anti-galectin-3 C-terminus antibody and an anti-galectin-3 N-terminus antibody. jkwon@medicine.bsd.uchicago.edu Accepted 2016-OCT-18 AT 10:38 BST AT 10:38 BST by PPORRAS Inflammatory bowel diseases 2011 Only protein-protein interactions imex curation imex curation leg3_human Galectin-3 LGALS3 MAC2 Galactose-specific lectin 3 Mac-2 antigen IgE-binding protein 35 kDa lectin Carbohydrate-binding protein 35 Laminin-binding protein Lectin L-29 L-31 Galactoside-binding protein protein protein human Homo sapiens Human MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI DIP protein P17931 original sequence version: 132 DIP protein P17931 original sequence version: 181 C49DDF6D67AE0C88 mmp7_human Matrilysin MMP7 MPSL1 Matrin Matrix metalloproteinase-7 PUMP1 Pump-1 protease Uterine metalloproteinase protein protein human Homo sapiens Human MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK F6BD1FC0ADA23603 lgals3-mmp7-1 2 6 enzyme target enzyme target substrate substrate neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 enzyme enzyme neutral component neutral component purified purified ecoli Escherichia coli (strain K12) protein cleavage protein cleavage 1 lgals3-mmp7-2 4 6 enzyme target enzyme target substrate substrate neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 enzyme enzyme neutral component neutral component purified purified ecoli Escherichia coli (strain K12) protein cleavage protein cleavage 2A lgals3-mmp7-3 1 6 enzyme target enzyme target substrate substrate neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 enzyme enzyme neutral component neutral component purified purified ecoli Escherichia coli (strain K12) protein cleavage protein cleavage 2 B/C lgals3-mmp7-4 3 6 enzyme target enzyme target substrate substrate neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 enzyme enzyme neutral component neutral component purified purified ecoli Escherichia coli (strain K12) protein cleavage protein cleavage 3 Galectin-3 cleavage products were only detected with the anti-galectin-3 C-terminus antibody, suggesting that MMP7 cleaves galectin-3 N-terminal sites. lgals3-mmp7-5 5 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization 4 co-localization was observed at the edge of the colonies.