IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The C-terminal region of human NFATc2 binds cJun to synergistically activate interleukin-2 transcription. The C-terminal region of human NFATc2 binds cJun to synergistically activate interleukin-2 transcription. Mol. Immunol. (0161-5890) 2010 imex curation Nguyen T.N., Kim L.J., Walters R.D., Drullinger L.F., Lively T.N., Kugel J.F., Goodrich J.A. IBD - Inflammatory bowel disease The HA- and GST-tagged human NFATc2 baculovirus constructs and those for in vitro translation of human NFATc2 are described in PMID:11231878 and PMID:11313476. The human pGEX-cFOS and pET-cJun constructs are described in PMID:11600717, while the pGEX-cJun is described in PMID:11316804. Construction of the c-Jun construct for in vitro translation was assumed to be done with the previously described c-Jun cDNA, which is of human origin. The expression construct and purification of human TAF4 is described in PMID:11313476. Luciferase reporter construct for the human IL2 promoter is described in PMID:11743717. Expression and purification of proteins from insect cells were performed as described in PMID:11231878. james.goodrich@colorado.edu,jennifer.kugel@colorado.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-jurkat Homo sapiens jurkat Human T cell leukemia ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Nguyen T.N., Kim L.J., Walters R.D., Drullinger L.F., Lively T.N., Kugel J.F., Goodrich J.A. IBD - Inflammatory bowel disease The HA- and GST-tagged human NFATc2 baculovirus constructs and those for in vitro translation of human NFATc2 are described in PMID:11231878 and PMID:11313476. The human pGEX-cFOS and pET-cJun constructs are described in PMID:11600717, while the pGEX-cJun is described in PMID:11316804. Construction of the c-Jun construct for in vitro translation was assumed to be done with the previously described c-Jun cDNA, which is of human origin. The expression construct and purification of human TAF4 is described in PMID:11313476. Luciferase reporter construct for the human IL2 promoter is described in PMID:11743717. Expression and purification of proteins from insect cells were performed as described in PMID:11231878. james.goodrich@colorado.edu,jennifer.kugel@colorado.edu Accepted 2015-JAN-22 by MGT Mol. Immunol. (0161-5890) 2010 Only protein-protein interactions imex curation The C-terminal region of human NFATc2 binds cJun to synergistically activate interleukin-2 transcription. The C-terminal region of human NFATc2 binds cJun to synergistically activate interleukin-2 transcription. Mol. Immunol. (0161-5890) 2010 imex curation Nguyen T.N., Kim L.J., Walters R.D., Drullinger L.F., Lively T.N., Kugel J.F., Goodrich J.A. IBD - Inflammatory bowel disease The HA- and GST-tagged human NFATc2 baculovirus constructs and those for in vitro translation of human NFATc2 are described in PMID:11231878 and PMID:11313476. The human pGEX-cFOS and pET-cJun constructs are described in PMID:11600717, while the pGEX-cJun is described in PMID:11316804. Construction of the c-Jun construct for in vitro translation was assumed to be done with the previously described c-Jun cDNA, which is of human origin. The expression construct and purification of human TAF4 is described in PMID:11313476. Luciferase reporter construct for the human IL2 promoter is described in PMID:11743717. Expression and purification of proteins from insect cells were performed as described in PMID:11231878. james.goodrich@colorado.edu,jennifer.kugel@colorado.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Nguyen T.N., Kim L.J., Walters R.D., Drullinger L.F., Lively T.N., Kugel J.F., Goodrich J.A. IBD - Inflammatory bowel disease Pull down was performed with untreated proteins or proteins treated with micrococcal nuclease to degrade any contaminating nucleic acids. The HA- and GST-tagged human NFATc2 baculovirus constructs and those for in vitro translation of human NFATc2 are described in PMID:11231878 and PMID:11313476. The human pGEX-cFOS and pET-cJun constructs are described in PMID:11600717, while the pGEX-cJun is described in PMID:11316804. Construction of the c-Jun construct for in vitro translation was assumed to be done with the previously described c-Jun cDNA, which is of human origin. The expression construct and purification of human TAF4 is described in PMID:11313476. Luciferase reporter construct for the human IL2 promoter is described in PMID:11743717. Expression and purification of proteins from insect cells were performed as described in PMID:11231878. james.goodrich@colorado.edu,jennifer.kugel@colorado.edu Accepted 2015-JAN-22 by MGT Mol. Immunol. (0161-5890) 2010 Only protein-protein interactions imex curation The C-terminal region of human NFATc2 binds cJun to synergistically activate interleukin-2 transcription. The C-terminal region of human NFATc2 binds cJun to synergistically activate interleukin-2 transcription. Mol. Immunol. (0161-5890) 2010 imex curation Nguyen T.N., Kim L.J., Walters R.D., Drullinger L.F., Lively T.N., Kugel J.F., Goodrich J.A. IBD - Inflammatory bowel disease The HA- and GST-tagged human NFATc2 baculovirus constructs and those for in vitro translation of human NFATc2 are described in PMID:11231878 and PMID:11313476. The human pGEX-cFOS and pET-cJun constructs are described in PMID:11600717, while the pGEX-cJun is described in PMID:11316804. Construction of the c-Jun construct for in vitro translation was assumed to be done with the previously described c-Jun cDNA, which is of human origin. The expression construct and purification of human TAF4 is described in PMID:11313476. Luciferase reporter construct for the human IL2 promoter is described in PMID:11743717. Expression and purification of proteins from insect cells were performed as described in PMID:11231878. james.goodrich@colorado.edu,jennifer.kugel@colorado.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Nguyen T.N., Kim L.J., Walters R.D., Drullinger L.F., Lively T.N., Kugel J.F., Goodrich J.A. IBD - Inflammatory bowel disease The HA- and GST-tagged human NFATc2 baculovirus constructs and those for in vitro translation of human NFATc2 are described in PMID:11231878 and PMID:11313476. The human pGEX-cFOS and pET-cJun constructs are described in PMID:11600717, while the pGEX-cJun is described in PMID:11316804. Construction of the c-Jun construct for in vitro translation was assumed to be done with the previously described c-Jun cDNA, which is of human origin. The expression construct and purification of human TAF4 is described in PMID:11313476. Luciferase reporter construct for the human IL2 promoter is described in PMID:11743717. Expression and purification of proteins from insect cells were performed as described in PMID:11231878. james.goodrich@colorado.edu,jennifer.kugel@colorado.edu Accepted 2015-JAN-22 by MGT Mol. Immunol. (0161-5890) 2010 Only protein-protein interactions imex curation The C-terminal region of human NFATc2 binds cJun to synergistically activate interleukin-2 transcription. The C-terminal region of human NFATc2 binds cJun to synergistically activate interleukin-2 transcription. Mol. Immunol. (0161-5890) 2010 imex curation Nguyen T.N., Kim L.J., Walters R.D., Drullinger L.F., Lively T.N., Kugel J.F., Goodrich J.A. IBD - Inflammatory bowel disease The HA- and GST-tagged human NFATc2 baculovirus constructs and those for in vitro translation of human NFATc2 are described in PMID:11231878 and PMID:11313476. The human pGEX-cFOS and pET-cJun constructs are described in PMID:11600717, while the pGEX-cJun is described in PMID:11316804. Construction of the c-Jun construct for in vitro translation was assumed to be done with the previously described c-Jun cDNA, which is of human origin. The expression construct and purification of human TAF4 is described in PMID:11313476. Luciferase reporter construct for the human IL2 promoter is described in PMID:11743717. Expression and purification of proteins from insect cells were performed as described in PMID:11231878. james.goodrich@colorado.edu,jennifer.kugel@colorado.edu 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Nguyen T.N., Kim L.J., Walters R.D., Drullinger L.F., Lively T.N., Kugel J.F., Goodrich J.A. IBD - Inflammatory bowel disease The HA- and GST-tagged human NFATc2 baculovirus constructs and those for in vitro translation of human NFATc2 are described in PMID:11231878 and PMID:11313476. The human pGEX-cFOS and pET-cJun constructs are described in PMID:11600717, while the pGEX-cJun is described in PMID:11316804. Construction of the c-Jun construct for in vitro translation was assumed to be done with the previously described c-Jun cDNA, which is of human origin. The expression construct and purification of human TAF4 is described in PMID:11313476. Luciferase reporter construct for the human IL2 promoter is described in PMID:11743717. Expression and purification of proteins from insect cells were performed as described in PMID:11231878. james.goodrich@colorado.edu,jennifer.kugel@colorado.edu Accepted 2015-JAN-22 by MGT Mol. Immunol. (0161-5890) 2010 Only protein-protein interactions imex curation il2_human_gene Human IL-2 gene IL2 gene gene human Homo sapiens Human nfac2_human Nuclear factor of activated T-cells, cytoplasmic 2 T-cell transcription factor NFAT1 NFAT pre-existing subunit NFATC2 NFAT1 NFATP protein protein human Homo sapiens Human MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGSAVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGERRNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNEIIRKEFSGPPARNQT DIP protein Q13469 original sequence version: 99 DIP protein Q13469 original sequence version: 100 DIP protein Q13469 original sequence version: 167 8DAE86855CCB58D3 nfac1_human Nuclear factor of activated T-cells, cytoplasmic 1 NFATC1 NFAT2 NFATC NFAT transcription complex cytosolic component protein protein human Homo sapiens Human MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSNVSPALPLPTAHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRIEITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSWLGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSPPPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPAPTCGPVSQGLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLSPAAYTKGVASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPGQPPPALLPQQVSAPPSSSCPPGLEHSLCPSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS DIP protein O95644 original sequence version: 141 DIP protein O95644 original sequence version: 156 E72FAB10ECEB2D66 jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF DIP protein P05412 original sequence version: 119 DIP protein P05412 original sequence version: 114 DIP protein P05412 original sequence version: 185 DIP protein P05412 original sequence version: 145 DIP protein P05412 original sequence version: 202 DIP protein P05412 original sequence version: 206 DIP protein P05412 original sequence version: 163 DIP protein P05412 original sequence version: 175 DIP protein P05412 original sequence version: 189 DIP protein P05412 original sequence version: 169 0695E23AC4D33561 q13469-2 Nuclear factor of activated T-cells, cytoplasmic 2 B NFATC2 NFAT1 NFATP NFAT pre-existing subunit T-cell transcription factor NFAT1 protein protein human Homo sapiens Human MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGSAVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGERRNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDELIDTHLSWIQNIL DIP protein Q13469-2 original sequence version: 125 71C45C9B348AE9C8 taf4_human Transcription initiation factor TFIID subunit 4 TAF4 TAF2C TAF2C1 TAF4A TAFII130 TAFII135 TBP-associated factor 4 Transcription initiation factor TFIID 135 kDa subunit Transcription initiation factor TFIID 130 kDa subunit RNA polymerase II TBP-associated factor subunit C protein protein human Homo sapiens Human MAAGSDLLDEVFFNSEVDEKVVSDLVGSLESQLAASAAHHHHLAPRTPEVRAAAAGALGNHVVSGSPAGAAGAGPAAPAEGAPGAAPEPPPAGRARPGGGGPQRPGPPSPRRPLVPAGPAPPAAKLRPPPEGSAGSCAPVPAAAAVAAGPEPAPAGPAKPAGPAALAARAGPGPGPGPGPGPGPGPGKPAGPGAAQTLNGSAALLNSHHAAAPAVSLVNNGPAALLPLPKPAAPGTVIQTPPFVGAAAPPAPAAPSPPAAPAPAAPAAAPPPPPPAPATLARPPGHPAGPPTAAPAVPPPAAAQNGGSAGAAPAPAPAAGGPAGVSGQPGPGAAAAAPAPGVKAESPKRVVQAAPPAAQTLAASGPASTAASMVIGPTMQGALPSPAAVPPPAPGTPTGLPKGAAGAVTQSLSRTPTATTSGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQAHAQPQTTMAPRPATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATLQRSPGVQPQLVLGGAAQTASLGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPPTSQATTALTAVVLSSSVQRTAGKTAATVTSALQPPVLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNPLQPVPVVKPAVLPGTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLLQAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGSGAEGSGPGSVVPGSSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK DIP protein O00268 original sequence version: 153 DIP protein O00268 original sequence version: 139 BC2F5B5F143DB145 fos_human Proto-oncogene c-Fos Cellular oncogene fos G0/G1 switch regulatory protein 7 FOS G0S7 protein protein human Homo sapiens Human MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL DIP protein P01100 original sequence version: 99 DIP protein P01100 original sequence version: 166 DIP protein P01100 original sequence version: 186 DIP protein P01100 original sequence version: 156 9E3B2969347C90C8 nfatc2-il2 1 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 1a phorbol myristate acetate (PMA) (CHEBI:37537) and ionomycin (CHEBI:63954) CHEBI:37537 and CHEBI:63954 increases binding of Q13469 to ENSG00000109471 CHEBI:37537 and CHEBI:63954 indirectly increases expression at RNA level of ENSG00000109471 Q13469 increases expression at RNA level of ENSG00000109471 Q13469 and P05412 increases expression at RNA level of ENSG00000109471 nfatc1-il2 1 5 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait association association Fig. 1a O95644 increases expression at RNA level of ENSG00000109471 jun-il2 1 5 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait association association Fig. 1a P05412 increases expression at RNA level of ENSG00000109471 fos-il2 1 11 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 1a P01100 increases expression at RNA level of ENSG00000109471 nfatc2-jun 2 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 8 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig. 3a In the absence of micrococcal nuclease, both full length NFATc2 and the DNA-binding domain of NFATc2 (residues 391-583; IPR011539) pulled down in vitro translated c-Jun; however, in the presence of micrococcal nuclease only full length NFATc2 was able to pull down c-Jun. jun-nfatc2 3 9 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction Fig. 3b, 4a, 6 This interaction was determined in the presence of micrococcal nuclease. human c-Fos (P01100) P01100 decreases binding of Q13469 to P05412 Q13469 increases binding of P05412 to O00268 Q13469 increases activity of P05412 P05412 increases activity of Q13469 jun-nfatc2-1 2 8 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association Fig. 5b jun-nfatc2-2 3 9 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 10 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association Fig. 6 In the absence of NFATc2, c-Jun did not pull down TAF4. nfatc2-jun-1 4 8 unspecified role unspecified role prey prey ecolx Escherichia coli 9 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction Fig. 7a nfatc2-jun-2 4 8 unspecified role unspecified role prey prey ecolx Escherichia coli 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction Fig. 7a