IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Kruppel-like factor KLF10 targets transforming growth factor-beta1 to regulate CD4(+)CD25(-) T cells and T regulatory cells. Kruppel-like factor KLF10 targets transforming growth factor-beta1 to regulate CD4(+)CD25(-) T cells and T regulatory cells. The Journal of biological chemistry 2009 imex curation Cao Z., Wara AK., Icli B., Sun X., Packard RR., Esen F., Stapleton CJ., Subramaniam M., Kretschmer K., Apostolou I., von Boehmer H., Hansson GK., Spelsberg TC., Libby P., Feinberg MW. IBD - Inflammatory bowel disease the chIp assay is stated (in fig legend) to have been done in Hela cells - everything else is done in mouse Tcells - so not much use. mfeinberg@rics.bwh.harvard.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Cao Z., Wara AK., Icli B., Sun X., Packard RR., Esen F., Stapleton CJ., Subramaniam M., Kretschmer K., Apostolou I., von Boehmer H., Hansson GK., Spelsberg TC., Libby P., Feinberg MW. IBD - Inflammatory bowel disease the chIp assay is stated (in fig legend) to have been done in Hela cells - everything else is done in mouse Tcells - so not much use. mfeinberg@rics.bwh.harvard.edu Accepted 2015-JUL-31 by PPORRAS The Journal of biological chemistry 2009 Only protein-protein interactions imex curation imex curation klf10_human Krueppel-like factor 10 Transforming growth factor-beta-inducible early growth response protein 1 EGR-alpha KLF10 TIEG TIEG1 protein protein human Homo sapiens Human MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKSLSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVDEKASAALYDFSVPSSETVICRSQPAPVSPQQKSVLVSPPAVSAGGVPPMPVICQMVPLPANNPVVTTVVPSTPPSQPPAVCPPVVFMGTQVPKGAVMFVVPQPVVQSSKPPVVSPNGTRLSPIAPAPGFSPSAAKVTPQIDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTHTGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALPPTPAPTQ 78B1EBB0DB97579D tgfb1_human_gene TGFB1_HUMAN_GENE gene gene human Homo sapiens Human 124-1 1 2 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey association association 2C KLF10 binding was reduced in the presence of the 453-bp TGF-β1 MUT promoter bearing a 2-bp mutation of the KLF binding site.