IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Transcriptional synergy mediated by SAF-1 and AP-1: critical role of N-terminal polyalanine and two zinc finger domains of SAF-1. Transcriptional synergy mediated by SAF-1 and AP-1: critical role of N-terminal polyalanine and two zinc finger domains of SAF-1. J. Biol. Chem. (0021-9258) 2009 imex curation Kumar D., Ray A., Ray B.K. IBD - Inflammatory bowel disease The expression constructs for human c-Fos and human c-Jun are described in PMID:11600717. The pAR vector containing a FLAG tag and a heart muscle kinase (HMK) phosphorylation site is described in PMID:1589769. The origin of the mouse MAZ/SAF-1 expression constructs was derived from a Blat genome search with the primer sequences used for PCR amplification. rayal@missouri.edu,rayb@missouri.edu 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Kumar D., Ray A., Ray B.K. IBD - Inflammatory bowel disease The expression constructs for human c-Fos and human c-Jun are described in PMID:11600717. The pAR vector containing a FLAG tag and a heart muscle kinase (HMK) phosphorylation site is described in PMID:1589769. The origin of the mouse MAZ/SAF-1 expression constructs was derived from a Blat genome search with the primer sequences used for PCR amplification. rayal@missouri.edu,rayb@missouri.edu Accepted 2014-DEC-22 by MGT J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation Transcriptional synergy mediated by SAF-1 and AP-1: critical role of N-terminal polyalanine and two zinc finger domains of SAF-1. Transcriptional synergy mediated by SAF-1 and AP-1: critical role of N-terminal polyalanine and two zinc finger domains of SAF-1. J. Biol. Chem. (0021-9258) 2009 imex curation Kumar D., Ray A., Ray B.K. IBD - Inflammatory bowel disease The expression constructs for human c-Fos and human c-Jun are described in PMID:11600717. The pAR vector containing a FLAG tag and a heart muscle kinase (HMK) phosphorylation site is described in PMID:1589769. The origin of the mouse MAZ/SAF-1 expression constructs was derived from a Blat genome search with the primer sequences used for PCR amplification. rayal@missouri.edu,rayb@missouri.edu 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Kumar D., Ray A., Ray B.K. IBD - Inflammatory bowel disease The expression constructs for human c-Fos and human c-Jun are described in PMID:11600717. The pAR vector containing a FLAG tag and a heart muscle kinase (HMK) phosphorylation site is described in PMID:1589769. The origin of the mouse MAZ/SAF-1 expression constructs was derived from a Blat genome search with the primer sequences used for PCR amplification. rayal@missouri.edu,rayb@missouri.edu Accepted 2014-DEC-22 by MGT J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation Transcriptional synergy mediated by SAF-1 and AP-1: critical role of N-terminal polyalanine and two zinc finger domains of SAF-1. Transcriptional synergy mediated by SAF-1 and AP-1: critical role of N-terminal polyalanine and two zinc finger domains of SAF-1. J. Biol. Chem. (0021-9258) 2009 imex curation Kumar D., Ray A., Ray B.K. IBD - Inflammatory bowel disease The expression constructs for human c-Fos and human c-Jun are described in PMID:11600717. The pAR vector containing a FLAG tag and a heart muscle kinase (HMK) phosphorylation site is described in PMID:1589769. The origin of the mouse MAZ/SAF-1 expression constructs was derived from a Blat genome search with the primer sequences used for PCR amplification. rayal@missouri.edu,rayb@missouri.edu 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-sw1353 Human chondrosarcoma SW1353 cells sw1353 Bone chondrosacrocoma SW1353 cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Kumar D., Ray A., Ray B.K. IBD - Inflammatory bowel disease The expression constructs for human c-Fos and human c-Jun are described in PMID:11600717. The pAR vector containing a FLAG tag and a heart muscle kinase (HMK) phosphorylation site is described in PMID:1589769. The origin of the mouse MAZ/SAF-1 expression constructs was derived from a Blat genome search with the primer sequences used for PCR amplification. rayal@missouri.edu,rayb@missouri.edu Accepted 2014-DEC-22 by MGT J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation Transcriptional synergy mediated by SAF-1 and AP-1: critical role of N-terminal polyalanine and two zinc finger domains of SAF-1. Transcriptional synergy mediated by SAF-1 and AP-1: critical role of N-terminal polyalanine and two zinc finger domains of SAF-1. J. Biol. Chem. (0021-9258) 2009 imex curation Kumar D., Ray A., Ray B.K. IBD - Inflammatory bowel disease The expression constructs for human c-Fos and human c-Jun are described in PMID:11600717. The pAR vector containing a FLAG tag and a heart muscle kinase (HMK) phosphorylation site is described in PMID:1589769. The origin of the mouse MAZ/SAF-1 expression constructs was derived from a Blat genome search with the primer sequences used for PCR amplification. rayal@missouri.edu,rayb@missouri.edu 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-sw1353 Human chondrosarcoma SW1353 cells sw1353 Bone chondrosacrocoma SW1353 cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kumar D., Ray A., Ray B.K. IBD - Inflammatory bowel disease The expression constructs for human c-Fos and human c-Jun are described in PMID:11600717. The pAR vector containing a FLAG tag and a heart muscle kinase (HMK) phosphorylation site is described in PMID:1589769. The origin of the mouse MAZ/SAF-1 expression constructs was derived from a Blat genome search with the primer sequences used for PCR amplification. rayal@missouri.edu,rayb@missouri.edu Accepted 2014-DEC-22 by MGT J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation Transcriptional synergy mediated by SAF-1 and AP-1: critical role of N-terminal polyalanine and two zinc finger domains of SAF-1. Transcriptional synergy mediated by SAF-1 and AP-1: critical role of N-terminal polyalanine and two zinc finger domains of SAF-1. J. Biol. Chem. (0021-9258) 2009 imex curation Kumar D., Ray A., Ray B.K. IBD - Inflammatory bowel disease The expression constructs for human c-Fos and human c-Jun are described in PMID:11600717. The pAR vector containing a FLAG tag and a heart muscle kinase (HMK) phosphorylation site is described in PMID:1589769. The origin of the mouse MAZ/SAF-1 expression constructs was derived from a Blat genome search with the primer sequences used for PCR amplification. rayal@missouri.edu,rayb@missouri.edu 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Kumar D., Ray A., Ray B.K. IBD - Inflammatory bowel disease The expression constructs for human c-Fos and human c-Jun are described in PMID:11600717. The pAR vector containing a FLAG tag and a heart muscle kinase (HMK) phosphorylation site is described in PMID:1589769. The origin of the mouse MAZ/SAF-1 expression constructs was derived from a Blat genome search with the primer sequences used for PCR amplification. rayal@missouri.edu,rayb@missouri.edu Accepted 2014-DEC-22 by MGT J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation Transcriptional synergy mediated by SAF-1 and AP-1: critical role of N-terminal polyalanine and two zinc finger domains of SAF-1. Transcriptional synergy mediated by SAF-1 and AP-1: critical role of N-terminal polyalanine and two zinc finger domains of SAF-1. J. Biol. Chem. (0021-9258) 2009 imex curation Kumar D., Ray A., Ray B.K. IBD - Inflammatory bowel disease The expression constructs for human c-Fos and human c-Jun are described in PMID:11600717. The pAR vector containing a FLAG tag and a heart muscle kinase (HMK) phosphorylation site is described in PMID:1589769. The origin of the mouse MAZ/SAF-1 expression constructs was derived from a Blat genome search with the primer sequences used for PCR amplification. rayal@missouri.edu,rayb@missouri.edu 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Kumar D., Ray A., Ray B.K. IBD - Inflammatory bowel disease The expression constructs for human c-Fos and human c-Jun are described in PMID:11600717. The pAR vector containing a FLAG tag and a heart muscle kinase (HMK) phosphorylation site is described in PMID:1589769. The origin of the mouse MAZ/SAF-1 expression constructs was derived from a Blat genome search with the primer sequences used for PCR amplification. rayal@missouri.edu,rayb@missouri.edu Accepted 2014-DEC-22 by MGT J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF DIP protein P05412 original sequence version: 119 DIP protein P05412 original sequence version: 114 DIP protein P05412 original sequence version: 185 DIP protein P05412 original sequence version: 145 DIP protein P05412 original sequence version: 202 DIP protein P05412 original sequence version: 206 DIP protein P05412 original sequence version: 163 DIP protein P05412 original sequence version: 175 DIP protein P05412 original sequence version: 189 DIP protein P05412 original sequence version: 169 0695E23AC4D33561 mmp1_human_saf1-site_dna-probe Human MMP1 gene promoter SAF-1 binding site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human CCACACACCTTGCTCCCAGGGCAGAGGGTGG mmp1_human_ap1-site_dna-probe Human MMP1 gene promoter AP-1 binding site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human GGGGATCCTATAAAGCATGAGTCAGACAGCCTC fos_human Proto-oncogene c-Fos Cellular oncogene fos G0/G1 switch regulatory protein 7 FOS G0S7 protein protein human Homo sapiens Human MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL DIP protein P01100 original sequence version: 99 DIP protein P01100 original sequence version: 166 DIP protein P01100 original sequence version: 186 DIP protein P01100 original sequence version: 156 9E3B2969347C90C8 maz_human Myc-associated zinc finger protein Transcription factor Zif87 Zinc finger protein 801 MAZ Purine-binding transcription factor Pur-1 ZF87 ZNF801 Serum amyloid A-activating factor-1 protein protein human Homo sapiens Human MFPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSRFFASQGCAQSPFQAAPAPPPTPQAPAAEPLQVDLLPVLAAAQESAAAAAAAAAAAAAVAAAPPAPAAASTVDTAALKQPPAPPPPPPPVSAPAAEAAPPASAATIAAAAATAVVAPTSTVAVAPVASALEKKTKSKGPYICALCAKEFKNGYNLRRHEAIHTGAKAGRVPSGAMKMPTMVPLSLLSVPQLSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHACEMCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKGTGEVCPMAAAAAAAAAAAAAAVAAPPTAVGSLSGAEGVPVSSQPLPSQPW C04C80F32C3C6825 maz_mouse Myc-associated zinc finger protein Maz Purine-binding transcription factor Pur-1 protein protein mouse Mus musculus Mouse MFPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSRFFASQGCAQSPFQAAPAPPPTPQAPAAEPLQVDLLPVLAAAQESAAAAAAAAAAAAAVVTAPPAPAAASTVDTAALKQPPAPPPPPPAVSAPAAEAAPPAAAATIAAAAATAVVAPTSTVAVAPVASVLEKKTKSKGPYICALCAKEFKNGYNLRRHEAIHTGAKAGRVPSGAMKMPTMVPLSLLSVPQLSGASGGGGEAGAGGGTTAVAAGGVVTTTASGKRIRKNHACEMCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKGTGEVCPMAAAAAAAAAAAAAVVAAPPTAVGSLSGAEGVPVSSQPLPSQPW F2276C4C7538D2EF comp_oligo_ap1-site_dna-probe Competitor oligonucleotide AP-1 binding site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) CGCTTGATGAGTCAGCCGGAA mmp1_human_gene Interstitial collagenase (MMP1) human gene gene gene human Homo sapiens Human comp_oligo_saf1-site_dna-probe Competitor oligonucleotide SAF-1 binding site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) CCCTTCCTCTCCACCCACAGCCCCCATGG maz-fos 2 12 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range rrasv tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 10 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction Fig. 3a maz-jun 2 12 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rrasv tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 7 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction Fig. 3a maz-fos-1 1 12 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range znf_c2h2 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 7 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli association association Fig. 3b, 7b No interaction was observed when GST-tagged SAF-1/MAZ was incubated separately with either His-tagged c-Fos or His-tagged c-Jun. maz-fos-2 4 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association Fig. 4a Interleukin-1 beta (IL-1beta) maz-mmp1 3 11 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey promoter region ap1 element binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4b Interleukin-1 beta (IL-1beta) P56270 increases expression at RNA level of ENSG00000196611 P56270 increases expression at protein level of ENSG00000196611 mmp1-fos 5 12 unspecified role unspecified role prey prey n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 10 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association Fig. 5b Addition of anti-MAZ/SAF-1 antibody resulted in a reduction of probe-bound complex, while addition of a mixture of anti-c-Fos and anti-c-Jun antibodies caused supershifting of the complex. mmp1-fos-1 5 12 unspecified role unspecified role prey prey n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 7 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 10 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 5e Addition of anti-MAZ/SAF-1 antibody resulted in a reduction of probe-bound complexes, while addition of a mixture of anti-c-Fos and anti-c-Jun antibodies caused supershifting of the c-Fos/c-Jun-containing complex. mmp1-jun 6 7 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 9 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Fig. 5b When tested separately, purified bacterially expressed c-Jun interacted very poorly with the radiolabeled AP-1 binding site DNA probe, while for c-Fos no binding to the probe was detected. In contrast, increased binding to the same probe was observed when both proteins were added (EBI-10041845). mmp1-fos-2 6 9 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 10 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association Fig. 5b P01100 and P05412 increases expression at RNA level of ENSG00000196611 P01100 and P05412 increases expression at protein level of ENSG00000196611 P01100 increases binding of P05412 to ENSG00000196611 P05412 increases binding of P01100 to ENSG00000196611 mmp1-comp 6 10 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 13 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli association association Fig. 5b mmp1-fos-3 6 12 unspecified role unspecified role prey prey n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 10 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association Fig. 5b mmp1-fos-4 6 12 unspecified role unspecified role prey prey n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 7 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli association association Fig. 5e comp-fos 6 12 unspecified role unspecified role prey prey n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 15 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 10 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association Fig. 5e mmp1-maz 6 12 unspecified role unspecified role prey prey n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Fig. 5e Binding of MAZ/SAF-1 to the radiolabeled SAF-1 binding site DNA probe was increased by addition of both purified bacterially expressed c-Jun and c-Fos (EBI-10041882). Without MAZ/SAF-1, a mixture of c-Fos and c-Jun did not interact with this probe.