IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ NF-kappaB p50 promotes tumor cell invasion through negative regulation of invasion suppressor gene CRMP-1 in human lung adenocarcinoma cells. NF-kappaB p50 promotes tumor cell invasion through negative regulation of invasion suppressor gene CRMP-1 in human lung adenocarcinoma cells. Biochem. Biophys. Res. Commun. (0006-291X) 2008 imex curation Gao M., Yeh P.Y., Lu Y.S., Chang W.C., Kuo M.L., Cheng A.L. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis IBD - Inflammatory bowel disease Apart from the sequence, there's not much information about the "emsa probe derived from immunoglobulin". I was not able to find a genomic match for the probe sequence. alcheng@ntu.edu.tw 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-cl1-0 Human CL 1.0 - Non small cell lung carcinoma cell line cl1-0 CL 1-0 human non small cell lung carcinoma cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Gao M., Yeh P.Y., Lu Y.S., Chang W.C., Kuo M.L., Cheng A.L. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis Apart from the sequence, there's not much information about the "emsa probe derived from immunoglobulin". I was not able to find a genomic match for the probe sequence. alcheng@ntu.edu.tw Accepted 2014-DEC-09 by ORCHARD Biochem. Biophys. Res. Commun. (0006-291X) 2008 Only protein-protein interactions imex curation NF-kappaB p50 promotes tumor cell invasion through negative regulation of invasion suppressor gene CRMP-1 in human lung adenocarcinoma cells. NF-kappaB p50 promotes tumor cell invasion through negative regulation of invasion suppressor gene CRMP-1 in human lung adenocarcinoma cells. Biochem. Biophys. Res. Commun. (0006-291X) 2008 imex curation Gao M., Yeh P.Y., Lu Y.S., Chang W.C., Kuo M.L., Cheng A.L. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis IBD - Inflammatory bowel disease Apart from the sequence, there's not much information about the "emsa probe derived from immunoglobulin". I was not able to find a genomic match for the probe sequence. alcheng@ntu.edu.tw 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-cl1-5 Human CL1-5 Non small cell lung carcinoma cell line cl-1-5 Human CL1-5 Non small cell lung carcinoma cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Gao M., Yeh P.Y., Lu Y.S., Chang W.C., Kuo M.L., Cheng A.L. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis Apart from the sequence, there's not much information about the "emsa probe derived from immunoglobulin". I was not able to find a genomic match for the probe sequence. alcheng@ntu.edu.tw Accepted 2014-DEC-09 by ORCHARD Biochem. Biophys. Res. Commun. (0006-291X) 2008 Only protein-protein interactions imex curation NF-kappaB p50 promotes tumor cell invasion through negative regulation of invasion suppressor gene CRMP-1 in human lung adenocarcinoma cells. NF-kappaB p50 promotes tumor cell invasion through negative regulation of invasion suppressor gene CRMP-1 in human lung adenocarcinoma cells. Biochem. Biophys. Res. Commun. (0006-291X) 2008 imex curation Gao M., Yeh P.Y., Lu Y.S., Chang W.C., Kuo M.L., Cheng A.L. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis IBD - Inflammatory bowel disease Apart from the sequence, there's not much information about the "emsa probe derived from immunoglobulin". I was not able to find a genomic match for the probe sequence. alcheng@ntu.edu.tw 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Gao M., Yeh P.Y., Lu Y.S., Chang W.C., Kuo M.L., Cheng A.L. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis Apart from the sequence, there's not much information about the "emsa probe derived from immunoglobulin". I was not able to find a genomic match for the probe sequence. alcheng@ntu.edu.tw Accepted 2014-DEC-09 by ORCHARD Biochem. Biophys. Res. Commun. (0006-291X) 2008 Only protein-protein interactions imex curation dpyl1_human_gene Dihydropyrimidinase-related protein 1 (CRMP1) human gene gene gene human Homo sapiens Human ig_nfkb-site_dna-probe Immunoglobulin gene promoter derived NF-kappaB site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) GGATTGGGACTTTCCCCTCC dpyl1_human_nfkb-site_dna-probe Human DPYL1 gene promoter NF-kappaB sequence DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human TGTAGGGGCTTTCTGCTCAG p19838-pro_0000030311 Nuclear factor NF-kappa-B p50 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG 1 433 5D027BB8EBCAA33A nfkb1-dpyl1-2 1 7 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 3b P19838-PRO_0000030311 decreases expression at protein level of ENSG00000072832 nfkb1-dpyl1-1 2 7 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 3b dpyl1-nfkb1-1 3 6 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey human-cl1-5 Human CL1-5 Non small cell lung carcinoma cell line cl-1-5 Human CL1-5 Non small cell lung carcinoma cell line physical association physical association Fig. 3c ig-nfkb1-1 3 5 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey human-cl1-5 Human CL1-5 Non small cell lung carcinoma cell line cl-1-5 Human CL1-5 Non small cell lung carcinoma cell line physical association physical association Fig. 1b Tumor necrosis factor-alpha (TNF-alpha)