IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Aberrant expression of Fra-2 promotes CCR4 expression and cell proliferation in adult T-cell leukemia. Aberrant expression of Fra-2 promotes CCR4 expression and cell proliferation in adult T-cell leukemia. Oncogene (0950-9232) 2008 imex curation Nakayama T., Hieshima K., Arao T., Jin Z., Nagakubo D., Shirakawa A.K., Yamada Y., Fujii M., Oiso N., Kawada A., Nishio K., Yoshie O. IBD - Inflammatory bowel disease The identity of the mouse c-Jun and human JunB, JunD, c-Fos, Fra1 and Fra2 expression constructs was obtained from PMID:11145887. o.yoshie@med.kindai.ac.jp 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-atl Homo sapiens adult T-cell lymphoma cell atl adult T-cell lymphoma cell ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Nakayama T., Hieshima K., Arao T., Jin Z., Nagakubo D., Shirakawa A.K., Yamada Y., Fujii M., Oiso N., Kawada A., Nishio K., Yoshie O. IBD - Inflammatory bowel disease Chromatin was immunoprecipitated from normal CD4+ T cells from healthy donors and primary ATL cells from two acute ATL patients. While specific binding of Fra2, JunB and JunD was not detected in normal CD4+ T cells, the interactions were consistently observed in the primary ATL cells from both patients. The identity of the mouse c-Jun and human JunB, JunD, c-Fos, Fra1 and Fra2 expression constructs was obtained from PMID:11145887. o.yoshie@med.kindai.ac.jp Accepted 2015-JAN-06 by MGT Oncogene (0950-9232) 2008 Only protein-protein interactions imex curation Aberrant expression of Fra-2 promotes CCR4 expression and cell proliferation in adult T-cell leukemia. Aberrant expression of Fra-2 promotes CCR4 expression and cell proliferation in adult T-cell leukemia. Oncogene (0950-9232) 2008 imex curation Nakayama T., Hieshima K., Arao T., Jin Z., Nagakubo D., Shirakawa A.K., Yamada Y., Fujii M., Oiso N., Kawada A., Nishio K., Yoshie O. IBD - Inflammatory bowel disease The identity of the mouse c-Jun and human JunB, JunD, c-Fos, Fra1 and Fra2 expression constructs was obtained from PMID:11145887. o.yoshie@med.kindai.ac.jp 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro solid phase assay solid phase assay antibody detection identification by antibody antibody detection Nakayama T., Hieshima K., Arao T., Jin Z., Nagakubo D., Shirakawa A.K., Yamada Y., Fujii M., Oiso N., Kawada A., Nishio K., Yoshie O. IBD - Inflammatory bowel disease "NoShift transcription factor assay"; A biotinylated oligonucleotide is mixed with the nuclear extract/ protein sample and the protein–DNA complex is captured on streptavidin coated plates. The bound protein is detected with a specific antibody followed by a second antibody–HRP conjugate and chromogenic substrate. In addition, unlabeled or mutant probes were added as competitors/specificity checks. The identity of the mouse c-Jun and human JunB, JunD, c-Fos, Fra1 and Fra2 expression constructs was obtained from PMID:11145887. o.yoshie@med.kindai.ac.jp Accepted 2015-JAN-06 by MGT Oncogene (0950-9232) 2008 Only protein-protein interactions imex curation fosl2_human Fos-related antigen 2 FOSL2 FRA2 protein protein human Homo sapiens Human MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL DIP protein P15408 original sequence version: 99 DIP protein P15408 original sequence version: 123 ccr4_human_ap1-site_dna-probe Human CCR4 gene promoter AP-1 site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human TGGGAAATGACTAAGAATCAT jund_human Transcription factor jun-D JUND protein protein human Homo sapiens Human METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY DIP protein P17535 original sequence version: 147 DIP protein P17535 original sequence version: 119 FE85A1AA2B5B9597 ccr4_human_gene C-C chemokine receptor type 4 (CCR4) human gene gene gene human Homo sapiens Human junb_human Transcription factor jun-B JUNB protein protein human Homo sapiens Human MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF DIP protein P17275 original sequence version: 151 DIP protein P17275 original sequence version: 118 DIP protein P17275 original sequence version: 143 DF8CD1CD4409C6BE fosl2-ccr4-1 1 6 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait association association Fig. 4b P15408 increases expression at RNA level of ENSG00000183813 P15408 and P17535 increases expression at RNA level of ENSG00000183813 P15408 and P17275 increases expression at RNA level of ENSG00000183813 junb-ccr4-1 1 6 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait association association Fig. 4b jund-ccr4-1 1 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4b P17535 increases expression at RNA level of ENSG00000183813 ccr4-fosl2-2 2 3 unspecified role unspecified role prey prey human-hut102 Homo sapiens peripheral blood cutaneous T-cell lymphoma cell line HuT 102 hut102 human peripheral blood cutaneous T-cell lymphoma cell line 4 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 4a ccr4-ccr4-1 2 3 unspecified role unspecified role prey prey human-hut102 Homo sapiens peripheral blood cutaneous T-cell lymphoma cell line HuT 102 hut102 human peripheral blood cutaneous T-cell lymphoma cell line 4 competitor competitor competitor prey prey a10t_t12a mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 4a ccr4-junb-2 2 7 unspecified role unspecified role prey prey human-hut102 Homo sapiens peripheral blood cutaneous T-cell lymphoma cell line HuT 102 hut102 human peripheral blood cutaneous T-cell lymphoma cell line 4 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 4a ccr4-ccr4-2 2 4 competitor competitor competitor prey prey a10t_t12a mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey human-hut102 Homo sapiens peripheral blood cutaneous T-cell lymphoma cell line HuT 102 hut102 human peripheral blood cutaneous T-cell lymphoma cell line 4 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 4a ccr4-jund-2 2 5 unspecified role unspecified role prey prey human-hut102 Homo sapiens peripheral blood cutaneous T-cell lymphoma cell line HuT 102 hut102 human peripheral blood cutaneous T-cell lymphoma cell line 4 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 4a ccr4-ccr4-3 2 5 unspecified role unspecified role prey prey human-st1 Homo sapiens adult T cell lymphoma cell line ST1 st1 Human adult T cell lymphoma cell line ST1 4 competitor competitor competitor prey prey a10t_t12a mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 4a ccr4-fosl2-1 2 4 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role prey prey human-st1 Homo sapiens adult T cell lymphoma cell line ST1 st1 Human adult T cell lymphoma cell line ST1 physical association physical association Fig. 4a ccr4-ccr4-4 2 3 unspecified role unspecified role prey prey human-st1 Homo sapiens adult T cell lymphoma cell line ST1 st1 Human adult T cell lymphoma cell line ST1 4 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 4 competitor competitor competitor prey prey a10t_t12a mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 4a ccr4-junb-1 2 7 unspecified role unspecified role prey prey human-st1 Homo sapiens adult T cell lymphoma cell line ST1 st1 Human adult T cell lymphoma cell line ST1 4 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 4a ccr4-ccr4-5 2 4 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey human-st1 Homo sapiens adult T cell lymphoma cell line ST1 st1 Human adult T cell lymphoma cell line ST1 4 competitor competitor competitor prey prey a10t_t12a mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 4a ccr4-jund-1 2 5 unspecified role unspecified role prey prey human-st1 Homo sapiens adult T cell lymphoma cell line ST1 st1 Human adult T cell lymphoma cell line ST1 4 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 4a ccr4-ccr4-6 2 4 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role prey prey human-hut102 Homo sapiens peripheral blood cutaneous T-cell lymphoma cell line HuT 102 hut102 human peripheral blood cutaneous T-cell lymphoma cell line 4 competitor competitor competitor prey prey a10t_t12a mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) association association Fig. 4a