IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. Hum. Mol. Genet. (0964-6906) 2005 Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Huntington's - Publications describing interactions involved in Huntington's disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Apoptosis - Interactions involving proteins with a function related to apoptosis A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de Annotation to indicate that this entry has been checked and accepted by a senior curator. Hum. Mol. Genet. (0964-6906) 2005 Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. Hum. Mol. Genet. (0964-6906) 2005 Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Huntington's - Publications describing interactions involved in Huntington's disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Apoptosis - Interactions involving proteins with a function related to apoptosis In some cases 3-AT was added to the growth medium to increase stringency of the assay due to autoactivation of reporter genes. A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de Annotation to indicate that this entry has been checked and accepted by a senior curator. Hum. Mol. Genet. (0964-6906) 2005 Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. Hum. Mol. Genet. (0964-6906) 2005 Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Huntington's - Publications describing interactions involved in Huntington's disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Apoptosis - Interactions involving proteins with a function related to apoptosis A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de Annotation to indicate that this entry has been checked and accepted by a senior curator. Hum. Mol. Genet. (0964-6906) 2005 Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. Hum. Mol. Genet. (0964-6906) 2005 Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Huntington's - Publications describing interactions involved in Huntington's disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Apoptosis - Interactions involving proteins with a function related to apoptosis A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de Annotation to indicate that this entry has been checked and accepted by a senior curator. Hum. Mol. Genet. (0964-6906) 2005 Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. Hum. Mol. Genet. (0964-6906) 2005 Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Huntington's - Publications describing interactions involved in Huntington's disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Apoptosis - Interactions involving proteins with a function related to apoptosis A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de Annotation to indicate that this entry has been checked and accepted by a senior curator. Hum. Mol. Genet. (0964-6906) 2005 Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. Hum. Mol. Genet. (0964-6906) 2005 Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Huntington's - Publications describing interactions involved in Huntington's disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Apoptosis - Interactions involving proteins with a function related to apoptosis A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de Annotation to indicate that this entry has been checked and accepted by a senior curator. Hum. Mol. Genet. (0964-6906) 2005 Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. Hum. Mol. Genet. (0964-6906) 2005 Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Huntington's - Publications describing interactions involved in Huntington's disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Apoptosis - Interactions involving proteins with a function related to apoptosis Synapse - Interactions of proteins with an established role in the presynapse. A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Apoptosis - Interactions involving proteins with a function related to apoptosis A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de Annotation to indicate that this entry has been checked and accepted by a senior curator. Hum. Mol. Genet. (0964-6906) 2005 sh3g1_human Endophilin-A2 Endophilin-2 SH3 domain-containing GRB2-like protein 1 SH3 domain protein 2B Extra eleven-nineteen leukemia fusion gene protein EEN fusion partner of MLL SH3GL1 CNSA1 SH3D2B protein protein human Homo sapiens Human MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPLPQ 6E5BE978BC955077 6E5BE978BC955077 plst_human Plastin-3 T-plastin PLS3 protein protein human Homo sapiens Human MDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKLMLDGDRNKDGKISFDEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV 631E6F803DC56A56 sh3g2_human Endophilin-A1 SH3GL2 CNSA2 SH3D2A Endophilin-1 SH3 domain-containing GRB2-like protein 2 SH3 domain protein 2A EEN-B1 protein protein human Homo sapiens Human MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPH DIP protein Q99962 original sequence version: 111 DIP protein Q99962 original sequence version: 141 F3AE2353E1EB7CF3 atx2_human Ataxin-2 Spinocerebellar ataxia type 2 protein Trinucleotide repeat-containing gene 13 protein SCA2 TNRC13 ATXN2 ATX2 protein protein human Homo sapiens Human MRSAAAAPRSPAVATESRRFAAARWPGWRSLQRPARRSGRGGGGAAPGPYPSAAPPPPGPGPPPSRQSSPPSASDCFGSNGNGGGAFRPGSRRLLGLGGPPRPFVVLLLPLASPGAPPAAPTRASPLGARASPPRSGVSLARPAPGCPRPACEPVYGPLTMSLKPQQQQQQQQQQQQQQQQQQQQQQQPPPAAANVRKPGGSGLLASPAAAPSPSSSSVSSSSATAPSSVVAATSGGGRPGLGRGRNSNKGLPQSTISFDGIYANMRMVHILTSVVGSKCEVQVKNGGIYEGVFKTYSPKCDLVLDAAHEKSTESSSGPKREEIMESILFKCSDFVVVQFKDMDSSYAKRDAFTDSAISAKVNGEHKEKDLEPWDAGELTANEELEALENDVSNGWDPNDMFRYNEENYGVVSTYDSSLSSYTVPLERDNSEEFLKREARANQLAEEIESSAQYKARVALENDDRSEEEKYTAVQRNSSEREGHSINTRENKYIPPGQRNREVISWGSGRQNSPRMGQPGSGSMPSRSTSHTSDFNPNSGSDQRVVNGGVPWPSPCPSPSSRPPSRYQSGPNSLPPRAATPTRPPSRPPSRPSRPPSHPSAHGSPAPVSTMPKRMSSEGPPRMSPKAQRHPRNHRVSAGRGSISSGLEFVSHNPPSEAATPPVARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSIGNTPSGPVLASPQAGIIPTEAVAMPIPAASPTPASPASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKPNETSPSFSKAENKGISPVVSEHRKQIDDLKKFKNDFRLQPSSTSESMDQLLNKNREGEKSRDLIKDKIEPSAKDSFIENSSSNCTSGSSKPNSPSISPSILSNTEHKRGPEVTSQGVQTSSPACKQEKDDKEEKKDAAEQVRKSTLNPNAKEFNPRSFSQPKPSTTPTSPRPQAQPSPSMVGHQQPTPVYTQPVCFAPNMMYPVPVSPGVQPLYPIPMTPMPVNQAKTYRAVPNMPQQRQDQHHQSAMMHPASAAGPPIAATPPAYSTQYVAYSPQQFPNQPLVQHVPHYQSQHPHVYSPVIQGNARMMAPPTHAQPGLVSSSATQYGAHEQTHAMYACPKLPYNKETSPSFYFAISTGSLAQQYAHPNATLHPHTPHPQPSATPTGQQQSQHGGSHPAPSPVQHHQHQAAQALHLASPQQQSAIYHAGLAPTPPSMTPASNTQSPQNSFPAAQQTVFTIHPSHVQPAYTNPPHMAHVPQAHVQSGMVPSHPTAHAPMMLMTTQPPGGPQAALAQSALQPIPVSTTAHFPYMTHPSVQAHHQQQL DIP protein Q99700 original sequence version: 90 40A2883FF9D5D118 plsl_human Plastin-2 L-plastin Lymphocyte cytosolic protein 1 LC64P LCP1 PLS2 protein protein human Homo sapiens Human MARGSVSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTNDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCNKIGNFSTDIKDSKAYYHLLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGNPKLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIGGQDLNEGNRTLTLALIWQLMRRYTLNILEEIGGGQKVNDDIIVNWVNETLREAKKSSSISSFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLMGKGMKRV DIP protein P13796 original sequence version: 177 668E4AA6A3FC7B58 sh3g3_human Endophilin-A3 Endophilin-3 SH3 domain-containing GRB2-like protein 3 SH3 domain protein 2C EEN-B2 SH3GL3 CNSA3 SH3D2C protein protein human Homo sapiens Human MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTGSNIPMDQPCCRGLYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ D68DA7B28574C4E6 hd_human Huntingtin HTT IT15 HD Huntington disease protein protein protein human Homo sapiens Human MATLEKLMKAFESLKSFQQQQQQQQQQQQQQQQQQQQQPPPPPPPPPPPQLPQPPPQAQPLLPQPQPPPPPPPPPPGPAVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALWRFAELAHLVRPQKCRPYLVNLLPCLTRTSKRPEESVQETLAAAVPKIMASFGNFANDNEIKVLLKAFIANLKSSSPTIRRTAAGSAVSICQHSRRTQYFYSWLLNVLLGLLVPVEDEHSTLLILGVLLTLRYLVPLLQQQVKDTSLKGSFGVTRKEMEVSPSAEQLVQVYELTLHHTQHQDHNVVTGALELLQQLFRTPPPELLQTLTAVGGIGQLTAAKEESGGRSRSGSIVELIAGGGSSCSPVLSRKQKGKVLLGEEEALEDDSESRSDVSSSALTASVKDEISGELAASSGVSTPGSAGHDIITEQPRSQHTLQADSVDLASCDLTSSATDGDEEDILSHSSSQVSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEIVLDGTDNQYLGLQIGQPQDEDEEATGILPDEASEAFRNSSMALQQAHLLKNMSHCRQPSDSSVDKFVLRDEATEPGDQENKPCRIKGDIGQSTDDDSAPLVHCVRLLSASFLLTGGKNVLVPDRDVRVSVKALALSCVGAAVALHPESFFSKLYKVPLDTTEYPEEQYVSDILNYIDHGDPQVRGATAILCGTLICSILSRSRFHVGDWMGTIRTLTGNTFSLADCIPLLRKTLKDESSVTCKLACTAVRNCVMSLCSSSYSELGLQLIIDVLTLRNSSYWLVRTELLETLAEIDFRLVSFLEAKAENLHRGAHHYTGLLKLQERVLNNVVIHLLGDEDPRVRHVAAASLIRLVPKLFYKCDQGQADPVVAVARDQSSVYLKLLMHETQPPSHFSVSTITRIYRGYNLLPSITDVTMENNLSRVIAAVSHELITSTTRALTFGCCEALCLLSTAFPVCIWSLGWHCGVPPLSASDESRKSCTVGMATMILTLLSSAWFPLDLSAHQDALILAGNLLAASAPKSLRSSWASEEEANPAATKQEEVWPALGDRALVPMVEQLFSHLLKVINICAHVLDDVAPGPAIKAALPSLTNPPSLSPIRRKGKEKEPGEQASVPLSPKKGSEASAASRQSDTSGPVTTSKSSSLGSFYHLPSYLKLHDVLKATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILELATLQDIGKCVEEILGYLKSCFSREPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQGRAQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQAEQENDTSGWFDVLQKVSTQLKTNLTSVTKNRADKNAIHNHIRLFEPLVIKALKQYTTTTCVQLQKQVLDLLAQLVQLRVNYCLLDSDQVFIGFVLKQFEYIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKENEDKWKRLSRQIADIILPMLAKQQMHIDSHEALGVLNTLFEILAPSSLRPVDMLLRSMFVTPNTMASVSTVQLWISGILAILRVLISQSTEDIVLSRIQELSFSPYLISCTVINRLRDGDSTSTLEEHSEGKQIKNLPEETFSRFLLQLVGILLEDIVTKQLKVEMSEQQHTFYCQELGTLLMCLIHIFKSGMFRRITAAATRLFRSDGCGGSFYTLDSLNLRARSMITTHPALVLLWCQILLLVNHTDYRWWAEVQQTPKRHSLSSTKLLSPQMSGEEEDSDLAAKLGMCNREIVRRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQDFISAVHRNSAASGLFIQAIQSRCENLSTPTMLKKTLQCLEGIHLSQSGAVLTLYVDRLLCTPFRVLARMVDILACRRVEMLLAANLQSSMAQLPMEELNRIQEYLQSSGLAQRHQRLYSLLDRFRLSTMQDSLSPSPPVSSHPLDGDGHVSLETVSPDKDWYVHLVKSQCWTRSDSALLEGAELVNRIPAEDMNAFMMNSEFNLSLLAPCLSLGMSEISGGQKSALFEAAREVTLARVSGTVQQLPAVHHVFQPELPAEPAAYWSKLNDLFGDAALYQSLPTLARALAQYLVVVSKLPSHLHLPPEKEKDIVKFVVATLEALSWHLIHEQIPLSLDLQAGLDCCCLALQLPGLWSVVSSTEFVTHACSLIYCVHFILEAVAVQPGEQLLSPERRTNTPKAISEEEEEVDPNTQNPKYITAACEMVAEMVESLQSVLALGHKRNSGVPAFLTPLLRNIIISLARLPLVNSYTRVPPLVWKLGWSPKPGGDFGTAFPEIPVEFLQEKEVFKEFIYRINTLGWTSRTQFEETWATLLGVLVTQPLVMEQEESPPEEDTERTQINVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGRKLSIIRGIVEQEIQAMVSKRENIATHHLYQAWDPVPSLSPATTGALISHEKLLLQINPERELGSMSYKLGQVSIHSVWLGNSITPLREEEWDEEEEEEADAPAPSSPPTSPVNSRKHRAGVDIHSCSQFLLELYSRWILPSSSARRTPAILISEVVRSLLVVSDLFTERNQFELMYVTLTELRRVHPSEDEILAQYLVPATCKAAAVLGMDKAVAEPVSRLLESTLRSSHLPSRVGALHGVLYVLECDLLDDTAKQLIPVISDYLLSNLKGIAHCVNIHSQQHVLVMCATAFYLIENYPLDVGPEFSASIIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAALGLMLTCMYTGKEKVSPGRTSDPNPAAPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDIMNKVIGEFLSNQQPYPQFMATVVYKVFQTLHSTGQSSMVRDWVMLSLSNFTQRAPVAMATWSLSCFFVSASTSPWVAAILPHVISRMGKLEQVDVNLFCLVATDFYRHQIEEELDRRAFQSVLEVVAAPGSPYHRLLTCLRNVHKVTTC DIP protein P42858 original sequence version: 148 DIP protein P42858 original sequence version: 145 DIP protein P42858 original sequence version: 142 DIP protein P42858 original sequence version: 157 DIP protein P42858 original sequence version: 158 DIP protein P42858 original sequence version: 156 A267509E84D52F0D atx2-cnsa3 1 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association atx2-cnsa3-1 2 11 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-697851]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 351-351, sequence length 347 [EBI-697851]295-351 physical association physical association It was demonstrated that increased length of the polyglutamine region did not affect interaction between ATX2 and SH3GL3 proteins as shown by LacZ activity assay. atx2-cnsa1 2 10 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association atx2-cnsa1-1 7 10 unspecified role unspecified role prey prey n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain n terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association atx2-cnsa3-2 7 11 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain n terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 13 unspecified role unspecified role prey prey n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association atx2-cnsa1-2 4 11 unspecified role unspecified role prey prey n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 physical association physical association Authors note that a small amount of ataxin-2 protein (residues 117-126) was found in immunopreciptates of SH3GL2 but could be explained by heterodimer complexs of endophillin proteins with affinities for different regions of ataxin-2. atx2-cnsa3-3 4 13 unspecified role unspecified role bait bait n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 11 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association cnsa1-cnsa2 2 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association cnsa1-cnsa3 2 13 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association cnsa1-cnsa1 2 10 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association cnsa2-cnsa2 2 8 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association cnsa3-cnsa3 2 13 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association cnsa2-cnsa3-1 2 8 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association cnsa2-cnsa1 2 10 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association cnsa3-cnsa1-1 2 13 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association cnsa3-cnsa2 2 10 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association cnsa1-cnsa1-1 7 10 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association cnsa1-cnsa3-1 7 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association cnsa3-cnsa2-1 7 13 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association cnsa3-cnsa3-1 7 13 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association cnas3-atx2 2 14 inhibitor inhibitor ancillary ancillary region exon 1 region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role bait bait physical association physical association ATX2 and huntingtin (exon 1 peptide sequence) compete for binding to endophilin-A3. lcp1-atx2 3 12 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association This interaction was not detected using a directed yeast two hybrid assay. tcp1-atx2-1 3 9 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association This interaction was not detected using a directed yeast two hybrid assay. tcp1-atx2-3 5 11 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization The ATX2/T-plastin complex co-localised in the perinuclear area and cytoplasmic area of cells studied. lcp1-atx2-2 5 11 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization The ATX2/T-plastin complex co-localised in the perinuclear area and cytoplasmic area of cells studied. tcp1-atx2-4 6 11 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization The ATX2/T-plastin complex co-localised in the perinuclear area and cytoplasmic area of cells studied. lcp1-atx2-3 6 12 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component colocalization colocalization The ATX2/T-plastin complex co-localised in the perinuclear area and cytoplasmic area of cells studied.