IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Comprehensive survey of proteins targeted by chloroplast thioredoxin. Comprehensive survey of proteins targeted by chloroplast thioredoxin. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 imex curation Motohashi K., Kondoh A., Stumpp MT., Hisabori T., Motohashi K., Kondoh A., Stumpp MT., Hisabori T. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species A mutant form of thioredoxin m (Trx-m) was utilised in these experiments which lacks the second cysteine residue within the active site. Only protein-protein interactions imex curation in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom edman degradation edman degradation Motohashi K., Kondoh A., Stumpp MT., Hisabori T. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species A mutant form of thioredoxin m (Trx-m) was utilised in these experiments which lacks the second cysteine residue within the active site. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 IMEx Comprehensive survey of proteins targeted by chloroplast thioredoxin. Comprehensive survey of proteins targeted by chloroplast thioredoxin. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 imex curation Motohashi K., Kondoh A., Stumpp MT., Hisabori T., Motohashi K., Kondoh A., Stumpp MT., Hisabori T. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species A mutant form of thioredoxin m (Trx-m) was utilised in these experiments which lacks the second cysteine residue within the active site. Only protein-protein interactions imex curation in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Motohashi K., Kondoh A., Stumpp MT., Hisabori T. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species interaction type will be reduction reaction when available. A mutant form of thioredoxin m (Trx-m) was utilised in these experiments which lacks the second cysteine residue within the active site. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 IMEx Comprehensive survey of proteins targeted by chloroplast thioredoxin. Comprehensive survey of proteins targeted by chloroplast thioredoxin. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 imex curation Motohashi K., Kondoh A., Stumpp MT., Hisabori T., Motohashi K., Kondoh A., Stumpp MT., Hisabori T. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species A mutant form of thioredoxin m (Trx-m) was utilised in these experiments which lacks the second cysteine residue within the active site. Only protein-protein interactions imex curation in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Motohashi K., Kondoh A., Stumpp MT., Hisabori T. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species interaction detection by emsa when CV2.5 in place. A mutant form of thioredoxin m (Trx-m) was utilised in these experiments which lacks the second cysteine residue within the active site. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 IMEx s17p_spiol Sedoheptulose-1,7-bisphosphatase, chloroplastic SED(1,7)P2ase Sedoheptulose bisphosphatase protein protein spiol Spinacia oleracea (Spinach) Spinach METSMACCSRSIVLPRVSPQHSSALVPSSINLKSLKSSSLFGESLRMTTKSSVRVNKAKNSSLVTKCELGDSLEEFLAKATTDKGLIRLMMCMGEALRTIGFKVRTASCGGTQCVNTFGDEQLAIDVLADKLLFEALNYSHFCKYACSEELPELQDMGGPVDGGFSVAFDPLDGSSIVDTNFSVGTIFGVWPGDKLTGVTGRDQVAAAMGIYGPRTTYVLALKDYPGTHEFLLLDEGKWQHVKETTEINEGKLFCPGNLRATSDNADYAKLIQYYIKEKYTLRYTGGMVPDVNQIIVKEKGIFTNVISPTAKAKLRLLFEVAPLGFLIEKAGGHSSEGTKSVLDIEVKNLDDRTQVAYGSLNEIIRFEKTLYGSSRLEEPVPVGAAA 746AE554C6844B79 g3pb_spiol Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic NADP-dependent glyceraldehydephosphate dehydrogenase subunit B GAPB GPB1 protein protein spiol Spinacia oleracea (Spinach) Spinach MASHAALAPSRIPASTRLASKASQQYSFLTQCSFKRLDVADFSGLRSSNSVTFTREASFHDVIAAQLTTKPTGAAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGLEGSVASGDPLEDFCKDNPADEECKLYE DIP protein P12860 original sequence version: 113 45D826A6DA5B4837 p10871-2 Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic 41 kDa protein protein spiol Spinacia oleracea (Spinach) Spinach MATAVSTVGAATRAPLNLNGSSAGASVPTSGFLGSSLKKHTNVRFPSSSRTTSMTVKAAENEEKNTDKWAHLAKDFSDDQLDIRRGKGMVDSLFQAPADAGTHVPIQSSFEYESQGLRKYDIDNMLGDFYIAPAFMDKLVVHITKNFLNLPNIKIPLILGVWGGKGQGKSFQCELVFAKLGINPIMMSAGELESGNAGEPAKLIRQRYREAADLIAKGKMCALFINDLEPGAGRMGGTTQYTVNNQMVNATLMNIADNPTNVQLPGMYNKQDNARVPIIVTGNDFSTLYAPLIRDGRMEKFYWAPTREDRIGVCTGIFKTDKVPAEHVVKLVDAFPGQSIDFFGALRARVYHDEVRKWVNSVGVDNVGKKLVNSKDGPPVFEQPEMTLQKLMEYGNMLVQEQENVKRVQLADQYMSSAALGDANKDAIDRGTFFG 98CAB9E225FDB65D bas1_spiol 2-Cys peroxiredoxin BAS1, chloroplastic Thiol-specific antioxidant protein Thioredoxin-dependent peroxiredoxin BAS1 BAS1 protein protein spiol Spinacia oleracea (Spinach) Spinach MACVASSTTLISSPSSRVFPAKSSLSSPSVSFLRTLSSPSASASLRSGFARRSSLSSTSRRSFAVKAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYTGNPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI 11F479093C2F573B rbs2_spiol Ribulose bisphosphate carboxylase small subunit, chloroplastic 2 RBCS2 protein protein spiol Spinacia oleracea (Spinach) Spinach MASSVLSSAAVATVSRTPAQASMVAPFTGLKSTVGFPATKKNDDITSLASNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFIAYKPAGY 651FF2F212CFD64A tlp20_spiol Peptidyl-prolyl cis-trans isomerase TLP20, chloroplastic Thylakoid lumen PPIase of 20 kDa Thylakoid lumenal 18 kDa protein P18 Rotamase protein protein spiol Spinacia oleracea (Spinach) Spinach SAEETPLQSKVTNKVYFDISIGNPVGKVVIGLFGDDVPQTAENFR 36155223724C01EA prxq_arath Peroxiredoxin Q, chloroplastic Thioredoxin-dependent peroxiredoxin Q MPE11_21 At3g26060 PRXQ Thioredoxin peroxidase protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAASSSSFTLCNHTTLRTLPLRKTLVTKTQFSVPTKSSESNFFGSTLTHSSYISPVSSSSLKGLIFAKVNKGQAAPDFTLKDQNGKPVSLKKYKGKPVVLYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSASHKAFASKYKLPYTLLSDEGNKVRKDWGVPGDLFGALPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLKAA 5DACF66AC059D10E trxm_spiol Thioredoxin M-type, chloroplastic protein protein spiol Spinacia oleracea (Spinach) Spinach MAIENCLQLSTSASVGTVAVKSHVHHLQPSSKVNVPTFRGLKRSFPALSSSVSSSSPRQFRYSSVVCKASEAVKEVQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYLSP DIP protein P07591 original sequence version: 103 5127D4BDF72D81E9 cp20c_arath Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic Rotamase cyclophilin-4 Cyclophilin of 20 kDa 3 Cyclosporin A-binding protein CYP20-3 At3g62030 F21F14.200 ROC4 Rotamase CYP20-3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSSSMQMVHTSRSIAQIGFGVKSQLVSANRTTQSVCFGARSSGIALSSRLHYASPIKQFSGVYATTKHQRTACVKSMAAEEEEVIEPQAKVTNKVYFDVEIGGEVAGRIVMGLFGEVVPKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGSQFFICTVKTSWLDNKHVVFGQVIEGMKLVRTLESQETRAFDVPKKGCRIYACGELPLDA DIP protein P34791 original sequence version: SP_64 DIP protein P34791 original sequence version: 91 D412AECBB8A5A3B7 trxm-atpam-2 1 6 unspecified role unspecified role prey prey spiol Spinacia oleracea (Spinach) Spinach 11 unspecified role unspecified role bait bait p.Cys107Ser Cysteine to serine subsititution at postion 41within the active site mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed Jul 06 17:45:09 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'cys41ser' ecobb Escherichia coli (strain B / BL21) physical association physical association trxm-gapb-1 1 5 unspecified role unspecified role prey prey spiol Spinacia oleracea (Spinach) Spinach 11 unspecified role unspecified role bait bait P07591:p.Cys107Ser Cysteine to serine subsititution at postion 41within the active site mutation mutation certain certain sequence position certain certain certain sequence position certain C S Tue Jun 30 19:32:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys107Ser' ecobb Escherichia coli (strain B / BL21) physical association physical association trxm-s17p-1 1 4 unspecified role unspecified role prey prey spiol Spinacia oleracea (Spinach) Spinach 11 unspecified role unspecified role bait bait P07591:p.Cys107Ser Cysteine to serine subsititution at postion 41within the active site mutation mutation certain certain sequence position certain certain certain sequence position certain C S Tue Jun 30 20:05:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys107Ser' ecobb Escherichia coli (strain B / BL21) physical association physical association trxm-bas1-1 1 7 unspecified role unspecified role prey prey spiol Spinacia oleracea (Spinach) Spinach 11 unspecified role unspecified role bait bait P07591:p.Cys107Ser Cysteine to serine subsititution at postion 41within the active site mutation mutation certain certain sequence position certain certain certain sequence position certain C S Tue Jun 30 19:37:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys107Ser' ecobb Escherichia coli (strain B / BL21) physical association physical association trxm-tlp20-1 1 11 unspecified role unspecified role bait bait P07591:p.Cys107Ser Cysteine to serine subsititution at postion 41within the active site mutation mutation certain certain sequence position certain certain certain sequence position certain C S Tue Jun 30 18:43:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys107Ser' ecobb Escherichia coli (strain B / BL21) 9 unspecified role unspecified role prey prey spiol Spinacia oleracea (Spinach) Spinach physical association physical association trxm-rbs2-1 1 8 unspecified role unspecified role prey prey spiol Spinacia oleracea (Spinach) Spinach 11 unspecified role unspecified role bait bait P07591:p.Cys107Ser Cysteine to serine subsititution at postion 41within the active site mutation mutation certain certain sequence position certain certain certain sequence position certain C S Tue Jun 30 18:07:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys107Ser' ecobb Escherichia coli (strain B / BL21) physical association physical association trxm-prxq-2 3 10 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) 11 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) physical association physical association trxm-cyp-1 3 11 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) 12 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) physical association physical association trxm-prxq-1 2 10 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) 11 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) physical association physical association