IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction of the soluble recombinant PsaD subunit of spinach photosystem I with ferredoxin I. Interaction of the soluble recombinant PsaD subunit of spinach photosystem I with ferredoxin I. Biochemistry (0006-2960) 1999 Pandini V., Aliverti A., Zanetti G. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Cross-linking of purified proteins using 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC). fig 4, fig 8 gzanetti@unimi.it in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Pandini V., Aliverti A., Zanetti G. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Cross-linking of purified proteins using 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC). fig 4, fig 8 gzanetti@unimi.it Annotation to indicate that this entry has been checked and accepted by a senior curator. Biochemistry (0006-2960) 1999 Interaction of the soluble recombinant PsaD subunit of spinach photosystem I with ferredoxin I. Interaction of the soluble recombinant PsaD subunit of spinach photosystem I with ferredoxin I. Biochemistry (0006-2960) 1999 Pandini V., Aliverti A., Zanetti G. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Cross-linking of purified proteins using 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC). fig 4, fig 8 gzanetti@unimi.it in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Pandini V., Aliverti A., Zanetti G. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Cross-linking of purified proteins using 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC). fig 4, fig 8 gzanetti@unimi.it Annotation to indicate that this entry has been checked and accepted by a senior curator. Biochemistry (0006-2960) 1999 fer1_spiol Ferredoxin-1, chloroplastic Ferredoxin I PETF protein protein spiol Spinacia oleracea (Spinach) Spinach MAATTTTMMGMATTFVPKPQAPPMMAALPSNTGRSLFGLKTGSRGGRMTMAAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKEEELTA 76045050A0AA8697 psad_spiol Photosystem I reaction center subunit II, chloroplastic Photosystem I 20 kDa subunit psaD protein protein spiol Spinacia oleracea (Spinach) Spinach MAMATQATLFSPSSLSSAKPIDTRLTTSFKQPSAVTFASKPASRHHSIRAAAAAEGKAAAATETKEAPKGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGLNMRSIGKNVSPIEVKFTGKQPYDL BC5FF64D97A6570E fenr_spiol Ferredoxin--NADP reductase, chloroplastic PETH protein protein spiol Spinacia oleracea (Spinach) Spinach MTTAVTAAVSFPSTKTTSLSARSSSVISPDKISYKKVPLYYRNVSATGKMGPIRAQIASDVEAPPPAPAKVEKHSKKMEEGITVNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGEDKNGKPHKLRLYSIASSALGDFGDAKSVSLCVKRLIYTNDAGETIKGVCSNFLCDLKPGAEVKLTGPVGKEMLMPKDPNATIIMLGTGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPDNFRLDFAVSREQTNEKGEKMYIQTRMAQYAVELWEMLKKDNTYFYMCGLKGMEKGIDDIMVSLAAAEGIDWIEYKRQLKKAEQWNVEVY 1D0432BA47438A28 psad-petf-1 2 3 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component extension tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association The psaD was expressed in E. coli with a 14 amino-acids extension at the N-terminus to avoid proteolysis . psad-petf-2 1 4 unspecified role unspecified role neutral component neutral component extension tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association The psaD was expressed in E. coli with a 14 amino-acids extension at the N-terminus to avoid proteolysis . Electrostatic interactions may be involved in stabilizing the complex PsaD and Fd because the increase of the medium ionic strength highly promoted complex dissociation high ionic strength. peth-petft-1 2 3 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association The psaD was expressed in E. coli with a 14 amino-acids extension at the N-terminus to avoid proteolysis .