IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Cryo-EM structure of SARS-CoV-2 ORF3a in lipid nanodiscs. Cryo-EM structure of SARS-CoV-2 ORF3a in lipid nanodiscs. Nature structural & molecular biology 2021 imex curation Kern DM., Sorum B., Mali SS., Hoel CM., Sridharan S., Remis JP., Toso DB., Kotecha A., Bautista DM., Brohawn SG., Kern DM., Sorum B., Mali SS., Hoel CM., Sridharan S., Remis JP., Toso DB., Kotecha A., Bautista DM., Brohawn SG. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus dbautista@berkeley.edu, brohawn@berkeley.edu Only protein-protein interactions imex curation spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 3d-em 3D electron microscopy 3D-EM electron tomog structure determination identification by structure determination identification by structure determination structure determination Kern DM., Sorum B., Mali SS., Hoel CM., Sridharan S., Remis JP., Toso DB., Kotecha A., Bautista DM., Brohawn SG. Virus - Publications including interactions involving viral proteins dbautista@berkeley.edu, brohawn@berkeley.edu Accepted 2021-JUL-16 AT 10:25 BST AT 10:25 BST by MARTA Nature structural & molecular biology 2021 Only protein-protein interactions imex curation imex curation Cryo-EM structure of SARS-CoV-2 ORF3a in lipid nanodiscs. Cryo-EM structure of SARS-CoV-2 ORF3a in lipid nanodiscs. Nature structural & molecular biology 2021 imex curation Kern DM., Sorum B., Mali SS., Hoel CM., Sridharan S., Remis JP., Toso DB., Kotecha A., Bautista DM., Brohawn SG., Kern DM., Sorum B., Mali SS., Hoel CM., Sridharan S., Remis JP., Toso DB., Kotecha A., Bautista DM., Brohawn SG. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus dbautista@berkeley.edu, brohawn@berkeley.edu Only protein-protein interactions imex curation in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog structure determination identification by structure determination identification by structure determination structure determination Kern DM., Sorum B., Mali SS., Hoel CM., Sridharan S., Remis JP., Toso DB., Kotecha A., Bautista DM., Brohawn SG. Virus - Publications including interactions involving viral proteins dbautista@berkeley.edu, brohawn@berkeley.edu Accepted 2021-JUL-16 AT 10:25 BST AT 10:25 BST by MARTA Nature structural & molecular biology 2021 Only protein-protein interactions imex curation imex curation ap3a_sars2 ORF3a protein Accessory protein 3a Protein U274 Protein X1 3a Protein 3a protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MDLFMRIFTIGTVTLKQGEIKDATPSDFVRATATIPIQASLPFGWLIVGVALLAVFQSASKIITLKKRWQLALSKGVHFVCNLLLLFVTVYSHLLLVAAGLEAPFLYLYALVYFLQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPYNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL apoa1_human Apolipoprotein A-I APOA1 Apolipoprotein A1 protein protein human Homo sapiens Human MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ DIP protein P02647 original sequence version: 116 DIP protein P02647 original sequence version: 125 DIP protein P02647 original sequence version: 147 DIP protein P02647 original sequence version: 162 1A28B8366E620310 ap3a_sars2-9 1 3 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction Table 1 ap3a_sars2-10 2 4 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction Table 1 ORF3a in Nanodiscs MSP1E3D1 (Membrane Scaffold Protein 1E3D1) = Apoa1 construct [apparently]