IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Cell discovery 2021 imex curation Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Only protein-protein interactions imex curation in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Accepted 2021-AUG-31 AT 04:39 BST AT 04:39 BST by KALPANAP Cell discovery 2021 Only protein-protein interactions imex curation imex curation Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Cell discovery 2021 imex curation Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Only protein-protein interactions imex curation in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins It has been assumed that Figure 3A interactions took place in PBMCs despite the Figure 3A text stating:- "the percentage ACE2+LSD1+ cells in the total Caco-2 population and each cell subset frequency of the total CD8+ T cells." The authors declined to reply to a request for information/clarification. (Caco-2 cells are colorectal adenocarcinoma cells -a heterogeneous mixture of intestinal epithelial cells.) no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. Peripheral blood mononuclear cells (PBMCs) were collected from COVID-19 patients. sudha.rao@qimrberghofer.edu.au Accepted 2021-AUG-31 AT 04:39 BST AT 04:39 BST by KALPANAP Cell discovery 2021 Only protein-protein interactions imex curation imex curation Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Cell discovery 2021 imex curation Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Only protein-protein interactions imex curation human-t-cell_cd8+ Homo sapiens CD8+ T lymphocytes t-cell_cd8+ CD8+ T lymphocytes facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins It has been assumed that Figure 3A interactions took place in PBMCs despite the Figure 3A text stating:- "the percentage ACE2+LSD1+ cells in the total Caco-2 population and each cell subset frequency of the total CD8+ T cells." The authors declined to reply to a request for information/clarification. (Caco-2 cells are colorectal adenocarcinoma cells -a heterogeneous mixture of intestinal epithelial cells.) no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Accepted 2021-AUG-31 AT 04:39 BST AT 04:39 BST by KALPANAP Cell discovery 2021 Only protein-protein interactions imex curation imex curation Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Cell discovery 2021 imex curation Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Only protein-protein interactions imex curation in vitro In vitro demethylase assay demethylase assay predetermined predetermined participant predetermined Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. Hydrogen peroxide (as well as formaldehyde) is produced by LSD1 during demethylation reactions. A fluorescent signal is generated via the horseradish peroxidase (HRP) catalyzed reaction of the generated hydrogen peroxide with a Red Peroxidase Substrate. sudha.rao@qimrberghofer.edu.au Accepted 2021-AUG-31 AT 04:39 BST AT 04:39 BST by KALPANAP Cell discovery 2021 Only protein-protein interactions imex curation imex curation Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Cell discovery 2021 imex curation Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Only protein-protein interactions imex curation in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight by comassie molecular weight estimation by coomasie staining weight by comassie Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Accepted 2021-AUG-31 AT 04:39 BST AT 04:39 BST by KALPANAP Cell discovery 2021 Only protein-protein interactions imex curation imex curation Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Cell discovery 2021 imex curation Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Only protein-protein interactions imex curation human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Accepted 2021-AUG-31 AT 04:39 BST AT 04:39 BST by KALPANAP Cell discovery 2021 Only protein-protein interactions imex curation imex curation Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Cell discovery 2021 imex curation Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Only protein-protein interactions imex curation human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Accepted 2021-AUG-31 AT 04:39 BST AT 04:39 BST by KALPANAP Cell discovery 2021 Only protein-protein interactions imex curation imex curation Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Cell discovery 2021 imex curation Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Only protein-protein interactions imex curation in vitro In vitro pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins In PLA experiments Figures 1F and 2F cells were treated with "0, 1, or 10 ng of SARS-CoV-2 spike protein." It is not known if this protein was the Spike S1 region aas Glu14-680 with C-terminal His tag, as used for ICC/IF, or not. The authors did not reply to a request for information. no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Accepted 2021-AUG-31 AT 04:39 BST AT 04:39 BST by KALPANAP Cell discovery 2021 Only protein-protein interactions imex curation imex curation Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Cell discovery 2021 imex curation Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Accepted 2021-AUG-31 AT 04:39 BST AT 04:39 BST by KALPANAP Cell discovery 2021 Only protein-protein interactions imex curation imex curation Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Cell discovery 2021 imex curation Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Only protein-protein interactions imex curation in vitro In vitro confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Accepted 2021-AUG-31 AT 04:39 BST AT 04:39 BST by KALPANAP Cell discovery 2021 Only protein-protein interactions imex curation imex curation Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Cell discovery 2021 imex curation Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Only protein-protein interactions imex curation human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Accepted 2021-AUG-31 AT 04:39 BST AT 04:39 BST by KALPANAP Cell discovery 2021 Only protein-protein interactions imex curation imex curation Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Cell discovery 2021 imex curation Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Only protein-protein interactions imex curation human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Accepted 2021-AUG-31 AT 04:39 BST AT 04:39 BST by KALPANAP Cell discovery 2021 Only protein-protein interactions imex curation imex curation Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Cell discovery 2021 imex curation Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Only protein-protein interactions imex curation human-pbmc Human Peripheral Blood Mononuclear cell peripheral_blood_mononuclear_cell Peripheral blood mononuclear cell confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Accepted 2021-AUG-31 AT 04:39 BST AT 04:39 BST by KALPANAP Cell discovery 2021 Only protein-protein interactions imex curation imex curation Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication. Cell discovery 2021 imex curation Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Only protein-protein interactions imex curation in vitro In vitro mst microscale thermophoresis mst predetermined predetermined participant predetermined Tu WJ., McCuaig RD., Melino M., Rawle DJ., Le TT., Yan K., Suhrbier A., Johnston RL., Koufariotis LT., Waddell N., Cross EM., Tsimbalyuk S., Bain A., Ahern E., Collinson N., Phipps S., Forwood JK., Seddiki N., Rao S. Virus - Publications including interactions involving viral proteins no reply to email requesting info/clarification on PLA Spike construct used, nor cells used in figure 3A - FACS. sudha.rao@qimrberghofer.edu.au Accepted 2021-AUG-31 AT 04:39 BST AT 04:39 BST by KALPANAP Cell discovery 2021 Only protein-protein interactions imex curation imex curation gsk2879552 GSK2879552 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) rcor1_human REST corepressor 1 RCOR1 KIAA0071 RCOR Protein CoREST protein protein human Homo sapiens Human MPAMVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSLAAAAPNGNSSSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLVWSPNQNLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS DIP protein Q9UKL0 original sequence version: 132 DIP protein Q9UKL0 original sequence version: 126 DIP protein Q9UKL0 original sequence version: 115 DIP protein Q9UKL0 original sequence version: 91 DIP protein Q9UKL0 original sequence version: 144 DIP protein Q9UKL0 original sequence version: 80 77E90FB0EFD514B2 tranylcypromine tranylcypromine DL-tranylcypromine Racemic Tranylcypromine SKF 385 SKF Trans-385 tranilcipromina trans-2-phenylcyclopropylamine trans-DL-2-Phenylcyclopropylamine Transamine Tranylcypromin tranylcypromine Tranylcypromine tranylcyprominum rac-(1R,2S)-2-phenylcyclopropan-1-amine (1R*,2S*)-2-phenylcyclopropan-1-amine (+-)-trans-2-phenylcyclopropylamine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) sp2509 SP2509 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) spike_sars2 Spike glycoprotein S E2 Peplomer protein 2 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT ace2_human Angiotensin-converting enzyme 2 ACE2 UNQ868/PRO1885 Angiotensin-converting enzyme homolog Metalloprotease MPROT15 Angiotensin-converting enzyme-related carboxypeptidase protein protein human Homo sapiens Human MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENPYASIDISKGENNPGFQNTDDVQTSF mint Carboxypeptidase which converts angiotensin I to angiotensin 1-9, a peptide of unknown function, and angiotensin II to angiotensin 1-7, a vasodilator. Also able to hydrolyze apelin-13 and dynorphin-13 with high efficiency. May be an important regulator of heart function. In case of human coronaviruses SARS and HCoV-NL63 infections, serve as functional receptor for the spike glycoprotein of both coronaviruses 8EE6EB0A931550E8 ima1_mouse Importin subunit alpha-1 Kpna2 Rch1 Importin alpha P1 Karyopherin subunit alpha-2 Pendulin Pore targeting complex 58 kDa subunit RAG cohort protein 1 SRP1-alpha protein protein mouse Mus musculus Mouse MSTNENANLPAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDEQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEKYFSVEEEEDQNVVPETTSEGFAFQVQDGAPGTFNF DIP protein P52293 original sequence version: 144 19E64AA3E9C3C7B5 kdm1a_human Lysine-specific histone demethylase 1A Flavin-containing amine oxidase domain-containing protein 2 BRAF35-HDAC complex protein BHC110 KDM1A KIAA0601 LSD1 AOF2 KDM1 [histone H3]-dimethyl-L-lysine(4) FAD-dependent demethylase 1A protein protein human Homo sapiens Human MLSGKKAAAAAAAAAAAATGTEAGPGTAGGSENGSEVAAQPAGLSGPAEVGPGAVGERTPRKKEPPRASPPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRRKRAKVEYREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPSM A61CEDE51E4E0C1D ncap_sars2 Nucleoprotein N Nucleocapsid protein protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA hdac2_human Histone deacetylase 2 HDAC2 protein protein human Homo sapiens Human MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP DIP protein Q92769 original sequence version: 161 DIP protein Q92769 original sequence version: 154 DIP protein Q92769 original sequence version: 117 DIP protein Q92769 original sequence version: 113 DIP protein Q92769 original sequence version: 139 DIP protein Q92769 original sequence version: 163 DIP protein Q92769 original sequence version: 179 DIP protein Q92769 original sequence version: 153 DIP protein Q92769 original sequence version: 112 775419CCCDAE07FA ace2-kpna2-1 9 20 unspecified role unspecified role neutral component neutral component purified purified region fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6-aminohexanoic acid tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 21 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 1 kdm1a-hdac2-2 12 24 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 16 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association 1D The methods section implies a non-specific HDAC antibody was used;however the antibody used to detect HDAC2 would appear to be specific for HDAC2 as the immunogen sequence (residues surrounding His438 of human HDAC2 protein) does not Blast to any of the many other HDAC proteins. ace2-s-99 8 20 unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma 19 unspecified role unspecified role neutral component neutral component purified purified physical association physical association 1F Transfected LSD1/KDM1A; Uniprot O60341 The sequence length for the SARS2 Spike protein is not stated. ace2-kdm1a-1 10 20 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma 22 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma colocalization colocalization 1K SARS-CoV-2 infection. Co-localization of LSD1 and ACE2 was seen at the cell surface of uninfected cells, and increased co-localization in SARS-CoV-2 infected cells. ace2-kdm1a-2 4 20 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain lys31 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 22 enzyme enzyme neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) demethylation demethylation reaction demethylation 2A, Lane1 ace2-kdm1a-3 4 20 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain lys31 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 22 enzyme enzyme neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 17 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) demethylation demethylation reaction demethylation 2A, Lane 2 ace2-kdm1a-4 4 20 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain lys31 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 22 enzyme enzyme neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) demethylation demethylation reaction demethylation 2A, Lane 3 ace2-kdm1a-5 4 20 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain lys31 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 22 enzyme enzyme neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 18 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) demethylation demethylation reaction demethylation 2A, Lane 5 It looks like DMSO is an inhibitor when used alone;however there is no statistical info given for this, and the text ignores this fact, thus so have I. Experiment carried out in the presence of DMSO. ace2-s-100 8 20 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell Q9BYF1:p.Lys31Phe mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K F Mon Jun 28 17:26:13 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys31Phe' human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma 19 unspecified role unspecified role neutral component neutral component purified purified physical association physical association 2F The sequence length for the SARS2 Spike protein is not stated. ace2-s-101 11 20 unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 19 unspecified role unspecified role neutral component neutral component infection infection proximity proximity close-contact colocalization neighbourhood interaction 2Q ACE2-01 peptide inhibitor (sequence unknown) ACE2-02 peptide inhibitor (sequence unknown) this was done using unpermeabilized cells which is meant to show cell surface localisation - but to me the images do not look like that, so I have removed the GO term. ace2-kdm1a-6 2 20 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-t cells cd 4+ Homo sapiens t-cell_cd4+ t cell cd4+ 22 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-t cells cd 4+ Homo sapiens t-cell_cd4+ t cell cd4+ colocalization colocalization 3A, Supp. figure 3 Both primary CD4+ and CD8+ T cells derived from a patient with severe COVID-19 had the highest cell surface LSD1–ACE2 co-expression. There was no significant difference in CD4+ T cell subset composition according to disease severity. ace2-kdm1a-7 2 20 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-t-cell_cd8+ Homo sapiens CD8+ T lymphocytes t-cell_cd8+ CD8+ T lymphocytes 22 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-t-cell_cd8+ Homo sapiens CD8+ T lymphocytes t-cell_cd8+ CD8+ T lymphocytes colocalization colocalization 3A, Supp. figure 3. Both primary CD4+ and CD8+ T cells derived from a patient with severe COVID-19 had the highest cell surface LSD1–ACE2 co-expression. There was no significant difference in CD4+ T cell subset composition according to disease severity. ace2-kdm1a-8 3 20 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization 3A, Supp. figure 3. Only CD8+ T cells, but not CD4+ T cells, expressed intracellular ACE2. There was a higher frequency of terminally differentiated TEMRA (CCR7-CD45RA+) CD8+ T cells in both moderate and severe COVID-19 patients compared to in mild COVID-19. The majority of ACE2+LSD1+ cells were naive (CD8+) T cells (CCR7+CD45RA+). ace2-kdm1a-9 10 20 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-pbmc Human Peripheral Blood Mononuclear cell peripheral_blood_mononuclear_cell Peripheral blood mononuclear cell 22 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-pbmc Human Peripheral Blood Mononuclear cell peripheral_blood_mononuclear_cell Peripheral blood mononuclear cell colocalization colocalization 3B Unpermeabilized PBMCs s from Covid-19 patients. Cells were CD8+. (As well as cytotoxic T-cells , Natural killer cells,and peripheral blood activated monocytes are all CD8+.) ace2-kdm1a-10 13 20 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization 3C Permeabilized PBMCs s from Covid-19 patients showing intracellular staining. Cells were CD8+. (As well as cytotoxic T-cells , Natural killer cells, and peripheral blood activated monocytes are all CD8+.) ace2-s-102 10 20 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma 19 unspecified role unspecified role neutral component neutral component purified purified S1 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain colocalization colocalization 3E (3D) Treatment with Spike protein induced nuclear translocation of ACE2. Nuclear ACE2 was also significantly induced in Caco-2 cells after SARS-CoV-2 infection (Fig. 3d-image not shown). ace2-kdm1a-11 7 20 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 23 unspecified role unspecified role neutral component neutral component infection infection 22 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization 4A There was also a significant increase in nuclear ACE2/LSD1 colocalization upon SARS-CoV-2 infection. ace2-kdm1a-12 7 20 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization 4A ace2-kdm1a-13 4 20 enzyme target enzyme target substrate substrate neutral component neutral component lys769, lys771 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain lys769 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain lys770 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain lys771 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 22 enzyme enzyme neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) demethylation demethylation reaction demethylation 4D Recombinant LSD1 showed the greatest demethylation of the double di-methylated ACE2 peptide (PEP4) followed by PEP3, PEP2, and PEP1. ace2-kpna2-2 14 20 unspecified role unspecified role neutral component neutral component purified purified region fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6-aminohexanoic acid tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 21 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 4H ace2-kpna2-3 1 20 unspecified role unspecified role neutral component neutral component purified purified region fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6-aminohexanoic acid tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 21 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 4H ace2-kpna2-4 5 20 weight by comassie molecular weight estimation by coomasie staining weight by comassie tag fluorescence tag visualisation by fluorescence tag fluorescence experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role purified purified region fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6-aminohexanoic acid tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 21 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 4I ace2-kdm1a-14 2 20 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-mrc5 Human foetal lung fibroblast-like cell line mrc5 Human foetal lung fibroblast-like cell line 22 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-mrc5 Human foetal lung fibroblast-like cell line mrc5 Human foetal lung fibroblast-like cell line colocalization colocalization Supp. figure 1C There was much higher ACE2 expression at the cell surface than intracellularly. I have not added an In vivo (intracellular) interaction for Mrc5 as coloc is ~5%. ace2-kdm1a-15 2 20 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma 22 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma colocalization colocalization 1B, Supp. 4C ACE2 and LSD1 expression at both the cell surface and intracellularly in Caco-2 cells, was not altered in the presence of the NACE2i peptide. ace2-kdm1a-16 6 20 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization 1B, Supp. figure 4C. ACE2 and LSD1 expression at both the cell surface and intracellularly in Caco-2 cells, was not altered in the presence of the NACE2i peptide. ace2-kdm1a-17 10 20 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-mrc5 Human foetal lung fibroblast-like cell line mrc5 Human foetal lung fibroblast-like cell line 22 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-mrc5 Human foetal lung fibroblast-like cell line mrc5 Human foetal lung fibroblast-like cell line colocalization colocalization Supp. 1E ace2-kdm1a-18 10 20 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. 22 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. colocalization colocalization Supp. 1E ace2-kdm1a-19 10 20 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma 22 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma colocalization colocalization Supp. 1E