IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SARS-coronavirus open reading frame-9b suppresses innate immunity by targeting mitochondria and the MAVS/TRAF3/TRAF6 signalosome. SARS-coronavirus open reading frame-9b suppresses innate immunity by targeting mitochondria and the MAVS/TRAF3/TRAF6 signalosome. Journal of immunology (Baltimore, Md. : 1950) 2014 imex curation Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH., Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus jkehrl@niaid.nih.gov Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH., Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH. Virus - Publications including interactions involving viral proteins jkehrl@niaid.nih.gov Accepted 2020-JUN-18 AT 09:15 BST AT 09:15 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation SARS-coronavirus open reading frame-9b suppresses innate immunity by targeting mitochondria and the MAVS/TRAF3/TRAF6 signalosome. SARS-coronavirus open reading frame-9b suppresses innate immunity by targeting mitochondria and the MAVS/TRAF3/TRAF6 signalosome. Journal of immunology (Baltimore, Md. : 1950) 2014 imex curation Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH., Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus jkehrl@niaid.nih.gov Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH., Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH. Virus - Publications including interactions involving viral proteins Myc-MAVS has been entered as being of Human origin due to sequence length. jkehrl@niaid.nih.gov Accepted 2020-JUN-18 AT 09:15 BST AT 09:15 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation SARS-coronavirus open reading frame-9b suppresses innate immunity by targeting mitochondria and the MAVS/TRAF3/TRAF6 signalosome. SARS-coronavirus open reading frame-9b suppresses innate immunity by targeting mitochondria and the MAVS/TRAF3/TRAF6 signalosome. Journal of immunology (Baltimore, Md. : 1950) 2014 imex curation Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH., Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus jkehrl@niaid.nih.gov Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH., Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH. Virus - Publications including interactions involving viral proteins jkehrl@niaid.nih.gov Accepted 2020-JUN-18 AT 09:15 BST AT 09:15 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation SARS-coronavirus open reading frame-9b suppresses innate immunity by targeting mitochondria and the MAVS/TRAF3/TRAF6 signalosome. SARS-coronavirus open reading frame-9b suppresses innate immunity by targeting mitochondria and the MAVS/TRAF3/TRAF6 signalosome. Journal of immunology (Baltimore, Md. : 1950) 2014 imex curation Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH., Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus jkehrl@niaid.nih.gov Only protein-protein interactions imex curation human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma super-resolution microscopy Super-resolution microscopy super resolution microscopy super-resolution microscopy immunocytochemistry immunocytochemistry Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH., Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH. Virus - Publications including interactions involving viral proteins STED microscopy (Stimulated emission depletion (STED) microscopy) ;it creates super-resolution images by the selective deactivation of fluorophores, minimising the area of illumination at the focal point, and thus enhancing the achievable resolution for a given system. jkehrl@niaid.nih.gov Accepted 2020-JUN-18 AT 09:15 BST AT 09:15 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation SARS-coronavirus open reading frame-9b suppresses innate immunity by targeting mitochondria and the MAVS/TRAF3/TRAF6 signalosome. SARS-coronavirus open reading frame-9b suppresses innate immunity by targeting mitochondria and the MAVS/TRAF3/TRAF6 signalosome. Journal of immunology (Baltimore, Md. : 1950) 2014 imex curation Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH., Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus jkehrl@niaid.nih.gov Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy immunocytochemistry immunocytochemistry Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH., Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH. Virus - Publications including interactions involving viral proteins 10 nm and 20 nm Gold-conjugated secondary antibodies were used. jkehrl@niaid.nih.gov Accepted 2020-JUN-18 AT 09:15 BST AT 09:15 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation SARS-coronavirus open reading frame-9b suppresses innate immunity by targeting mitochondria and the MAVS/TRAF3/TRAF6 signalosome. SARS-coronavirus open reading frame-9b suppresses innate immunity by targeting mitochondria and the MAVS/TRAF3/TRAF6 signalosome. Journal of immunology (Baltimore, Md. : 1950) 2014 imex curation Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH., Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus jkehrl@niaid.nih.gov Only protein-protein interactions imex curation human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH., Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH. Virus - Publications including interactions involving viral proteins jkehrl@niaid.nih.gov Accepted 2020-JUN-18 AT 09:15 BST AT 09:15 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation pcbp2_human Poly(rC)-binding protein 2 PCBP2 Alpha-CP2 Heterogeneous nuclear ribonucleoprotein E2 protein protein human Homo sapiens Human MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSIIECVKQICVVMLETLSQSPPKGVTIPYRPKPSSSPVIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWGLDASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYLINVRLSSETGGMGSS 43F035D76FDC2C63 mavs_human Mitochondrial antiviral-signaling protein Interferon beta promoter stimulator protein 1 Virus-induced-signaling adapter CARD adapter inducing interferon beta Putative NF-kappa-B-activating protein 031N MAVS IPS1 KIAA1271 VISA protein protein human Homo sapiens Human MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPRTSDRPPDPLEPPSLPAERPGPPTPAAAHSIPYNSCREKEPSYPMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSRGPVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPTTLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLPINSTRAGMVPSKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLH 0E23E3E115941EE8 dnm1l_human Dynamin-1-like protein Dynamin-like protein Dnm1p/Vps1p-like protein Dynamin family member proline-rich carboxyl-terminal domain less Dynamin-related protein 1 Dynamin-like protein 4 Dynamin-like protein IV DNM1L DLP1 DRP1 protein protein human Homo sapiens Human MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW F9521A376B785B71 F9521A376B785B71 orf9b_sars ORF9b protein Protein 9b 9b Accessory protein 9b ORF-9b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK 5166F22872915FCB dnm1l-orf9b_cvhsa-1 3 9 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 2C orf9b_cvhsa-mavs-1 1 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 3G mavs-orf9b_cvhsa-1 2 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 3H orf9b_cvhsa-mavs-2 6 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 10 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 4A mavs-orf9b_cvhsa-2 4 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 10 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 4B mavs-orf9b_cvhsa-3 5 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 4 C/D dnm1l-orf9b_cvhsa-2 3 8 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association 6B