UniProt UniProt http://www.uniprot.org A transmembrane serine protease is linked to the severe acute respiratory syndrome coronavirus receptor and activates virus entry. A transmembrane serine protease is linked to the severe acute respiratory syndrome coronavirus receptor and activates virus entry. Journal of Virology 2011 imex curation Shulla A., Heald-Sargent T., Subramanya G., Zhao J., Perlman S., Gallagher T., Shulla A., Heald-Sargent T., Subramanya G., Zhao J., Perlman S., Gallagher T. Coronavirus - Interactions investigated in the context of Coronavirus Cannot currently add IMEx ID tgallag@lumc.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Shulla A., Heald-Sargent T., Subramanya G., Zhao J., Perlman S., Gallagher T., Shulla A., Heald-Sargent T., Subramanya G., Zhao J., Perlman S., Gallagher T. Coronavirus - Interactions investigated in the context of Coronavirus Cannot currently add IMEx ID ACE2 was identifed by binding of a human IgG1 Fc-tagged form of the SARS S receptor binding domain. Origin of ACE2 protein taken from prvious work of contributing scientist (PMID: 15791205) tgallag@lumc.edu Accepted 2020-MAR-30 AT 10:25 BST AT 10:25 BST by PPORRAS Journal of Virology 2011 imex curation A transmembrane serine protease is linked to the severe acute respiratory syndrome coronavirus receptor and activates virus entry. A transmembrane serine protease is linked to the severe acute respiratory syndrome coronavirus receptor and activates virus entry. Journal of Virology 2011 imex curation Shulla A., Heald-Sargent T., Subramanya G., Zhao J., Perlman S., Gallagher T., Shulla A., Heald-Sargent T., Subramanya G., Zhao J., Perlman S., Gallagher T. Coronavirus - Interactions investigated in the context of Coronavirus Cannot currently add IMEx ID tgallag@lumc.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shulla A., Heald-Sargent T., Subramanya G., Zhao J., Perlman S., Gallagher T., Shulla A., Heald-Sargent T., Subramanya G., Zhao J., Perlman S., Gallagher T. Coronavirus - Interactions investigated in the context of Coronavirus Cannot currently add IMEx ID Origin of ACE2 protein taken from previous work of contributing scientist (PMID: 15791205) tgallag@lumc.edu Accepted 2020-MAR-30 AT 10:25 BST AT 10:25 BST by PPORRAS Journal of Virology 2011 imex curation tmps2_human Transmembrane protease serine 2 TMPRSS2 PRSS10 Serine protease 10 protein protein human Homo sapiens Human MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG C05B5531C8A311C7 ace2_human Angiotensin-converting enzyme 2 ACE2 UNQ868/PRO1885 Angiotensin-converting enzyme homolog Metalloprotease MPROT15 Angiotensin-converting enzyme-related carboxypeptidase protein protein human Homo sapiens Human MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENPYASIDISKGENNPGFQNTDDVQTSF mint Carboxypeptidase which converts angiotensin I to angiotensin 1-9, a peptide of unknown function, and angiotensin II to angiotensin 1-7, a vasodilator. Also able to hydrolyze apelin-13 and dynorphin-13 with high efficiency. May be an important regulator of heart function. In case of human coronaviruses SARS and HCoV-NL63 infections, serve as functional receptor for the spike glycoprotein of both coronaviruses 8EE6EB0A931550E8 ace2-tmprss2-1 2 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c9 tag TETSQVAPA tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 7A tmprss2-ace2-1 2 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c9 tag TETSQVAPA tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range O15393:p.Ser441Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 17:31:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser441Ala' physical association physical association Fig. 7A, 7B ace2-tmprss2-2 1 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c9 tag TETSQVAPA tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Fig. 6B