UniProt UniProt http://www.uniprot.org Sphingosine-1-phosphate produced by sphingosine kinase 2 in mitochondria interacts with prohibitin 2 to regulate complex IV assembly and respiration. Sphingosine-1-phosphate produced by sphingosine kinase 2 in mitochondria interacts with prohibitin 2 to regulate complex IV assembly and respiration. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 imex curation Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-heart Mus musculus heart [Cardiac; Cardiac tissue] heart Heart [Cardiac; Cardiac tissue] anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu Accepted 2020-APR-17 AT 11:29 BST AT 11:29 BST by PPORRAS FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Only protein-protein interactions imex curation imex curation Sphingosine-1-phosphate produced by sphingosine kinase 2 in mitochondria interacts with prohibitin 2 to regulate complex IV assembly and respiration. Sphingosine-1-phosphate produced by sphingosine kinase 2 in mitochondria interacts with prohibitin 2 to regulate complex IV assembly and respiration. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 imex curation Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Sphingolipids were quantified by liquid chromatography, electrospray ionization-tandem mass spectrometry (LC-ESI-MS/MS) Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu Accepted 2020-APR-17 AT 11:29 BST AT 11:29 BST by PPORRAS FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Only protein-protein interactions imex curation imex curation Sphingosine-1-phosphate produced by sphingosine kinase 2 in mitochondria interacts with prohibitin 2 to regulate complex IV assembly and respiration. Sphingosine-1-phosphate produced by sphingosine kinase 2 in mitochondria interacts with prohibitin 2 to regulate complex IV assembly and respiration. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 imex curation Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip tag visualisation tag visualisation Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu Accepted 2020-APR-17 AT 11:29 BST AT 11:29 BST by PPORRAS FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Only protein-protein interactions imex curation imex curation Sphingosine-1-phosphate produced by sphingosine kinase 2 in mitochondria interacts with prohibitin 2 to regulate complex IV assembly and respiration. Sphingosine-1-phosphate produced by sphingosine kinase 2 in mitochondria interacts with prohibitin 2 to regulate complex IV assembly and respiration. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 imex curation Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-heart Mus musculus heart [Cardiac; Cardiac tissue] heart Heart [Cardiac; Cardiac tissue] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu Accepted 2020-APR-17 AT 11:29 BST AT 11:29 BST by PPORRAS FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Only protein-protein interactions imex curation imex curation Sphingosine-1-phosphate produced by sphingosine kinase 2 in mitochondria interacts with prohibitin 2 to regulate complex IV assembly and respiration. Sphingosine-1-phosphate produced by sphingosine kinase 2 in mitochondria interacts with prohibitin 2 to regulate complex IV assembly and respiration. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 imex curation Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-heart Mus musculus heart [Cardiac; Cardiac tissue] heart Heart [Cardiac; Cardiac tissue] bn-page blue native page bn-page sequence tag sequence tag identification sequence tag Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu Accepted 2020-APR-17 AT 11:29 BST AT 11:29 BST by PPORRAS FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Only protein-protein interactions imex curation imex curation Sphingosine-1-phosphate produced by sphingosine kinase 2 in mitochondria interacts with prohibitin 2 to regulate complex IV assembly and respiration. Sphingosine-1-phosphate produced by sphingosine kinase 2 in mitochondria interacts with prohibitin 2 to regulate complex IV assembly and respiration. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 imex curation Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu Accepted 2020-APR-17 AT 11:29 BST AT 11:29 BST by PPORRAS FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Only protein-protein interactions imex curation imex curation Sphingosine-1-phosphate produced by sphingosine kinase 2 in mitochondria interacts with prohibitin 2 to regulate complex IV assembly and respiration. Sphingosine-1-phosphate produced by sphingosine kinase 2 in mitochondria interacts with prohibitin 2 to regulate complex IV assembly and respiration. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 imex curation Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu Accepted 2020-APR-17 AT 11:29 BST AT 11:29 BST by PPORRAS FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Only protein-protein interactions imex curation imex curation Sphingosine-1-phosphate produced by sphingosine kinase 2 in mitochondria interacts with prohibitin 2 to regulate complex IV assembly and respiration. Sphingosine-1-phosphate produced by sphingosine kinase 2 in mitochondria interacts with prohibitin 2 to regulate complex IV assembly and respiration. FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 imex curation Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom sequence tag sequence tag identification sequence tag Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Cell type taken from cited reference Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu Accepted 2020-APR-17 AT 11:29 BST AT 11:29 BST by PPORRAS FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Only protein-protein interactions imex curation imex curation phb_mouse Prohibitin Phb B-cell receptor-associated protein 32 protein protein mouse Mus musculus Mouse MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ 6B26073E169C2FFC phb2_mouse Prohibitin-2 B-cell receptor-associated protein BAP37 Repressor of estrogen receptor activity Phb2 Bap Bcap37 Rea protein protein mouse Mus musculus Mouse MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK A887CC982BF85C80 sphingosine 1-phosphate (2S,3R,4E)-2-amino-3-hydroxyoctadec-4-en-1-yl dihydrogen phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) cox2_mouse Cytochrome c oxidase subunit 2 Cytochrome c oxidase polypeptide II Mtco2 COII mt-Co2 COX2 protein protein mouse Mus musculus Mouse MAYPFQLGLQDATSPIMEELMNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAVILIMIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENWSASMI 306C6EAD54802D11 sphk2_mouse Sphingosine kinase 2 Sphk2 protein protein mouse Mus musculus Mouse MAPPPLLPVAASTPILHGEFGSYPANGPRFALTLTTQALHIQRLRPKPEARPRDGLVSLDEVSGCGTLQSRSPEDTAAYFCIYTYPRGRRGGRRRATRTFRADGATTYEENRAEAQRWATALTCLLRGVPLSGDQEITPELLPRKPRLLILVNPFGGRGLAWQRCMDHVVPMISEAGLSFNLIQTERQNHARELVQGLSLSEWEGIVTVSGDGLLYEVLNGLLDRPDWEDAVRMPIGVLPCGSGNALAGAVNHHGGFEQVVGVDLLLNCSLLLCRGGSHPLDLLSVTLASGSRCFSFLSVAWGFLSDVDIHSERFRALGSARFTLGAVLGLASLHTYRGRLSYLPATTEPALPIPGHSLPRAKSELVLAPAPAPAATHSPLHRSVSDLPLPLPQPALVSPGSPEPLPDLSLNGGGPELTGDWGGAGDAPLSPDPLLPSSPNALKTAQLSPIAEGPPEMPASSGFLPPTHSAPEASTWGPVDHLLPPLGSPLPQDWVTIEGEFVLMLGILPSHLCADLMAAPHARFDDGVVHLCWVRSGISRAALLRILLAMEHGNHFSLGCPHLGYAAARAFRLEPLTPRGLLTVDGELVEYGPIQAQVHPGLATLLTGPAGQKPQA 40EE2C2C288BE26A phb_human Prohibitin PHB PHB1 protein protein human Homo sapiens Human MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ 915494273E342C76 dihydrosphingosine-1-phosphate Dihydrosphingosine-1-phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) cox5b_mouse Cytochrome c oxidase subunit 5B, mitochondrial Cox5b Cytochrome c oxidase polypeptide Vb protein protein mouse Mus musculus Mouse MASRLLRGVGALAAQALRRTARGAAVTRSMASGGGVPTDEEQATGLEREIMIAAQKGLDPYNMLPPKAASGTKEDPNLVPSISNKRIVGCICEEDNCTVIWFWLHKGESQRCPNCGTHYKLVPHQMAH 84AA890F1A074383 cx7a1_mouse Cytochrome c oxidase subunit 7A1, mitochondrial Cox7a1 Cox7a Cox7ah Cytochrome c oxidase subunit VIIa-heart Cytochrome c oxidase subunit VIIa-muscle protein protein mouse Mus musculus Mouse MRALRVSQALVRSFSSSTRSHLENRVAEKQKLFQADNDLPVHLKGGGMDNVLYRLTMTLTLGGTAYCLYCLGWASFPHKK This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport mint 9C6FB6C8E6E4C340 cx6b1_mouse Cytochrome c oxidase subunit 6B1 Cox6b1 Cox6b Cytochrome c oxidase subunit VIb isoform 1 protein protein mouse Mus musculus Mouse MAEDIKTKIKNYKTAPFDSRFPNQNQTKNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPVSWVSAWDDRIAEGTFPGKI A2E96D96CC37509A phb2_human Prohibitin-2 BAP REA PHB2 D-prohibitin B-cell receptor-associated protein BAP37 Repressor of estrogen receptor activity protein protein human Homo sapiens Human MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK A887CC982BF85C80 cox1_mouse Cytochrome c oxidase subunit 1 Mtco1 COI mt-Co1 Cytochrome c oxidase polypeptide I protein protein mouse Mus musculus Mouse MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSILIRAELGQPGALLGDDQIYNVIVTAHAFVMIFFMVMPMMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGIISHVVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGLDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMLWALGFIFLFTVGGLTGIVLSNSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPLFSGFTLDDTWAKAHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTTWNTVSSMGSFISLTAVLIMIFMIWEAFASKREVMSVSYASTNLEWLHGCPPPYHTFEEPTYVKVK 9F7FB173ED6A9763 cox6c_mouse Cytochrome c oxidase subunit 6C Cytochrome c oxidase polypeptide VIc Cox6c protein protein mouse Mus musculus Mouse MSSGALLPKPQMRGLLAKRLRVHIAGAFIVALGVAAAYKFGVAEPRKKAYAEFYRNYDSMKDFEEMRKAGIFQSAK BE02A028CF77D5F4 cox5a_mouse Cytochrome c oxidase subunit 5A, mitochondrial Cox5a Cytochrome c oxidase polypeptide Va protein protein mouse Mus musculus Mouse MLAAALRRCTAAAAARGLLHPASAPSPAAAVCSIRCYSHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV 8F6AFF91B5C6160F cox41_mouse Cytochrome c oxidase subunit 4 isoform 1, mitochondrial Cox4i1 Cox4 Cox4a Cytochrome c oxidase subunit IV isoform 1 Cytochrome c oxidase polypeptide IV protein protein mouse Mus musculus Mouse MLASRALSLIGKRAISTSVCLRAHGSVVKSEDYAFPTYADRRDYPLPDVAHVTMLSASQKALKEKEKADWSSLSRDEKVQLYRIQFNESFAEMNRGTNEWKTVVGMAMFFIGFTALVLIWEKSYVYGPIPHTFDRDWVAMQTKRMLDMKANPIQGFSAKWDYDKNEWKK This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport mint D30B1DBBE14FDBEA sphingosine 1_phosphate-1 8 19 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 11 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 1A-C sphingosine 1_phosphate-phb2-1 7 19 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells 11 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 1D, E sphingosine 1_phosphate-phb2-2 7 11 competitor competitor competitor prey prey purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 19 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells 11 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 1E sphingosine 1_phosphate-phb2-3 3 19 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells 11 unspecified role unspecified role prey prey purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 1F phb2-sphingosine 1_phosphate-1 3 19 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 11 unspecified role unspecified role prey prey purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 2A phb2-sphingosine 1_phosphate-2 3 11 competitor competitor competitor prey prey purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 19 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 11 unspecified role unspecified role prey prey purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 2A, Supp Fig.1 phb2-dihydrosphingosine_1_phosphate-1 3 15 competitor competitor competitor prey prey purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 19 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 11 unspecified role unspecified role prey prey purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 2A phb-phb2-3 6 19 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 2B PHB1 was effectively immunoprecipitated by anti-PHB2 and vice versa (Fig. 2B). phb2-phb-1 6 19 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 2B,2F sphingosine 1_phosphate-phb2-4 2 19 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey physical association physical association Fig. 2C,D sphingosine 1_phosphate-phb2-5 7 19 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 11 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 2G phb2-phb-2 4 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 4C Interaction observed in sphk2-/-cells. phb2-phb-3 4 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 4C sphingosine 1_phosphate-phb2-6 7 11 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association Fig. 4E cox4i1-cox5a-4 5 17 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 23 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 21 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 18 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 16 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Supp. Table 2 phb2-cox4i1-1 4 23 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 20 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Supp. Fig. 3 Interaction observed in sphk2-/-cells but interaction with COX subuniits decreases phb2-sphingosine 1_phosphate-4 1 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey physical association physical association Fig. 2C,D