MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Severe acute respiratory syndrome coronavirus Orf3a protein interacts with caveolin. Severe acute respiratory syndrome coronavirus Orf3a protein interacts with caveolin. The Journal of general virology 2007 imex curation Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S., Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S. Coronavirus - Interactions investigated in the context of Coronavirus Caveolin1 is canine, I have checked the reference 10801850 shahid@icgeb.res.in 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-ht_29 Homo sapiens HT-29 caucasian women with colon adenocarcinoma ht_29 HT-29 confirmed as human with IEF of AST, LDH established from the primary tumor of a 44-year-old Caucasian woman with colon adenocarcinoma in 1964; described to be heterotransplantable forming well-differentiated grade I tumors fluorescence imaging fluorescence microscopy fluorescence imaging anti tag immunost anti tag immunostaining anti tag immunost Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S., Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S. Coronavirus - Interactions investigated in the context of Coronavirus Instead of punctate staining, the Δ3Cyto3a–HA protein showed a diffuse cytoplasmic distribution (Fig. 5cF5) and did not colocalize with caveolin-1. These results suggest that the presence of just one of the three potential caveolin-1-binding motifs is sufficient for the characteristic subcellular distribution of 3a and its colocalization with caveolin-1. Caveolin1 is canine, I have checked the reference 10801850 shahid@icgeb.res.in Accepted 2020-APR-15 AT 06:35 BST AT 06:35 BST by ORCHARD The Journal of general virology 2007 Only protein-protein interactions imex curation imex curation Severe acute respiratory syndrome coronavirus Orf3a protein interacts with caveolin. Severe acute respiratory syndrome coronavirus Orf3a protein interacts with caveolin. The Journal of general virology 2007 imex curation Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S., Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S. Coronavirus - Interactions investigated in the context of Coronavirus Caveolin1 is canine, I have checked the reference 10801850 shahid@icgeb.res.in 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line fluorescence imaging fluorescence microscopy fluorescence imaging anti tag immunost anti tag immunostaining anti tag immunost Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S., Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S. Coronavirus - Interactions investigated in the context of Coronavirus Instead of punctate staining, the Δ3Cyto3a–HA protein showed a diffuse cytoplasmic distribution (Fig. 5cF5) and did not colocalize with caveolin-1. These results suggest that the presence of just one of the three potential caveolin-1-binding motifs is sufficient for the characteristic subcellular distribution of 3a and its colocalization with caveolin-1. Caveolin1 is canine, I have checked the reference 10801850 shahid@icgeb.res.in Accepted 2020-APR-15 AT 06:35 BST AT 06:35 BST by ORCHARD The Journal of general virology 2007 Only protein-protein interactions imex curation imex curation Severe acute respiratory syndrome coronavirus Orf3a protein interacts with caveolin. Severe acute respiratory syndrome coronavirus Orf3a protein interacts with caveolin. The Journal of general virology 2007 imex curation Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S., Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S. Coronavirus - Interactions investigated in the context of Coronavirus Caveolin1 is canine, I have checked the reference 10801850 shahid@icgeb.res.in 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S., Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S. Coronavirus - Interactions investigated in the context of Coronavirus Caveolin1 is canine, I have checked the reference 10801850 shahid@icgeb.res.in Accepted 2020-APR-15 AT 06:35 BST AT 06:35 BST by ORCHARD The Journal of general virology 2007 Only protein-protein interactions imex curation imex curation Severe acute respiratory syndrome coronavirus Orf3a protein interacts with caveolin. Severe acute respiratory syndrome coronavirus Orf3a protein interacts with caveolin. The Journal of general virology 2007 imex curation Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S., Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S. Coronavirus - Interactions investigated in the context of Coronavirus Caveolin1 is canine, I have checked the reference 10801850 shahid@icgeb.res.in 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 fluorescence imaging fluorescence microscopy fluorescence imaging anti tag immunost anti tag immunostaining anti tag immunost Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S., Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S. Coronavirus - Interactions investigated in the context of Coronavirus Instead of punctate staining, the Δ3Cyto3a–HA protein showed a diffuse cytoplasmic distribution (Fig. 5cF5) and did not colocalize with caveolin-1. These results suggest that the presence of just one of the three potential caveolin-1-binding motifs is sufficient for the characteristic subcellular distribution of 3a and its colocalization with caveolin-1. Caveolin1 is canine, I have checked the reference 10801850 shahid@icgeb.res.in Accepted 2020-APR-15 AT 06:35 BST AT 06:35 BST by ORCHARD The Journal of general virology 2007 Only protein-protein interactions imex curation imex curation Severe acute respiratory syndrome coronavirus Orf3a protein interacts with caveolin. Severe acute respiratory syndrome coronavirus Orf3a protein interacts with caveolin. The Journal of general virology 2007 imex curation Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S., Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S. Coronavirus - Interactions investigated in the context of Coronavirus Caveolin1 is canine, I have checked the reference 10801850 shahid@icgeb.res.in 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S., Padhan K., Tanwar C., Hussain A., Hui PY., Lee MY., Cheung CY., Peiris JS., Jameel S. Coronavirus - Interactions investigated in the context of Coronavirus Caveolin1 is canine, I have checked the reference 10801850 shahid@icgeb.res.in Accepted 2020-APR-15 AT 06:35 BST AT 06:35 BST by ORCHARD The Journal of general virology 2007 Only protein-protein interactions imex curation imex curation ap3a_sars ORF3a protein Protein 3a Accessory protein 3a Protein U274 Protein X1 3a protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MDLFMRFFTLGSITAQPVKIDNASPASTVHATATIPLQASLPFGWLVIGVAFLAVFQSATKIIALNKRWQLALYKGFQFICNLLLLFVTIYSHLLLVAAGMEAQFLYLYALIYFLQCINACRIIMRCWLCWKCKSKNPLLYDANYFVCWHTHNYDYCIPYNSVTDTIVVTEGDGISTPKLKEDYQIGGYSEDRHSGVKDYVVVHGYFTEVYYQLESTQITTDTGIENATFFIFNKLVKDPPNVQIHTIDGSSGVANPAMDPIYDEPTTTTSVPL DIP protein P59632 original sequence version: 70 cav1_canlf Caveolin-1 CAV1 CAV Vesicular integral-membrane protein VIP21 protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAEEMSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPFFEAVGKIFSNIRINMQKET DD77CE4D436E508D ap3a_cvhsa-cav1-1 1 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell cfp tag cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization f5a f5b ap3a_cvhsa-cav1-2 3 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding region binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association f6 ap3a_cvhsa-cav1-3 5 7 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed living cell living cell cfp tag cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain proximity proximity close-contact colocalization neighbourhood interaction f7a f7b f7c ap3a_cvhsa-cav1-4 4 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell cfp tag cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization f5a f5b ap3a_cvhsa-cav1-5 2 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell cfp tag cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization f5a f5b