IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Histone-like TAFs within the PCAF histone acetylase complex. Histone-like TAFs within the PCAF histone acetylase complex. Cell (0092-8674) 1998 imex curation Ogryzko VV., Kotani T., Zhang X., Schiltz RL., Howard T., Yang XJ., Howard BH., Qin J., Nakatani Y. Chromatin - Epigenetic interactions resulting in chromatin modulation Results from Figure 6 have not been added to the entries since the proteins identified only by commassie blue staining. HeLa cells expressing FLAG epitope tagged PCAF. Nuclear extract was prepared from the resulting cells and fractionated on S:Sepharose. The epitope tagged PCAF was purified from this fraction by affinity chromatography on anti:FLAG antibody conjugated agarose. The bound polypeptides were eluted with the epitope peptide under native conditions. FLAG:PCAF was further purified by anti:PCAF antibody affinity chromatography. yoshi@helix.nih.gov 27-Aug-2008: Contacted by JYOTI. davet Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Ogryzko VV., Kotani T., Zhang X., Schiltz RL., Howard T., Yang XJ., Howard BH., Qin J., Nakatani Y. Chromatin - Epigenetic interactions resulting in chromatin modulation Results from Figure 6 have not been added to the entries since the proteins identified only by commassie blue staining. HeLa cells expressing FLAG epitope tagged PCAF. Nuclear extract was prepared from the resulting cells and fractionated on S:Sepharose. The epitope tagged PCAF was purified from this fraction by affinity chromatography on anti:FLAG antibody conjugated agarose. The bound polypeptides were eluted with the epitope peptide under native conditions. FLAG:PCAF was further purified by anti:PCAF antibody affinity chromatography. yoshi@helix.nih.gov Accepted 2008-AUG-23 by DAVET. 27-Aug-2008: Contacted by JYOTI. Cell (0092-8674) 1998 davet Only protein-protein interactions imex curation Histone-like TAFs within the PCAF histone acetylase complex. Histone-like TAFs within the PCAF histone acetylase complex. Cell (0092-8674) 1998 imex curation Ogryzko VV., Kotani T., Zhang X., Schiltz RL., Howard T., Yang XJ., Howard BH., Qin J., Nakatani Y. Chromatin - Epigenetic interactions resulting in chromatin modulation Results from Figure 6 have not been added to the entries since the proteins identified only by commassie blue staining. HeLa cells expressing FLAG epitope tagged PCAF. Nuclear extract was prepared from the resulting cells and fractionated on S:Sepharose. The epitope tagged PCAF was purified from this fraction by affinity chromatography on anti:FLAG antibody conjugated agarose. The bound polypeptides were eluted with the epitope peptide under native conditions. FLAG:PCAF was further purified by anti:PCAF antibody affinity chromatography. yoshi@helix.nih.gov 27-Aug-2008: Contacted by JYOTI. davet Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip fingerprinting peptide massfingerprinting fingerprinting Ogryzko VV., Kotani T., Zhang X., Schiltz RL., Howard T., Yang XJ., Howard BH., Qin J., Nakatani Y. Chromatin - Epigenetic interactions resulting in chromatin modulation Results from Figure 6 have not been added to the entries since the proteins identified only by commassie blue staining. HeLa cells expressing FLAG epitope tagged PCAF. Nuclear extract was prepared from the resulting cells and fractionated on S:Sepharose. The epitope tagged PCAF was purified from this fraction by affinity chromatography on anti:FLAG antibody conjugated agarose. The bound polypeptides were eluted with the epitope peptide under native conditions. FLAG:PCAF was further purified by anti:PCAF antibody affinity chromatography. yoshi@helix.nih.gov Accepted 2008-AUG-23 by DAVET. Cell (0092-8674) 1998 davet Only protein-protein interactions imex curation Histone-like TAFs within the PCAF histone acetylase complex. Histone-like TAFs within the PCAF histone acetylase complex. Cell (0092-8674) 1998 imex curation Ogryzko VV., Kotani T., Zhang X., Schiltz RL., Howard T., Yang XJ., Howard BH., Qin J., Nakatani Y. Chromatin - Epigenetic interactions resulting in chromatin modulation Results from Figure 6 have not been added to the entries since the proteins identified only by commassie blue staining. HeLa cells expressing FLAG epitope tagged PCAF. Nuclear extract was prepared from the resulting cells and fractionated on S:Sepharose. The epitope tagged PCAF was purified from this fraction by affinity chromatography on anti:FLAG antibody conjugated agarose. The bound polypeptides were eluted with the epitope peptide under native conditions. FLAG:PCAF was further purified by anti:PCAF antibody affinity chromatography. yoshi@helix.nih.gov 27-Aug-2008: Contacted by JYOTI. davet Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ogryzko VV., Kotani T., Zhang X., Schiltz RL., Howard T., Yang XJ., Howard BH., Qin J., Nakatani Y. Chromatin - Epigenetic interactions resulting in chromatin modulation Results from Figure 6 have not been added to the entries since the proteins identified only by commassie blue staining. HeLa cells expressing FLAG epitope tagged PCAF. Nuclear extract was prepared from the resulting cells and fractionated on S:Sepharose. The epitope tagged PCAF was purified from this fraction by affinity chromatography on anti:FLAG antibody conjugated agarose. The bound polypeptides were eluted with the epitope peptide under native conditions. FLAG:PCAF was further purified by anti:PCAF antibody affinity chromatography. yoshi@helix.nih.gov Accepted 2008-AUG-23 by DAVET. 27-Aug-2008: Contacted by JYOTI. Cell (0092-8674) 1998 davet Only protein-protein interactions imex curation Histone-like TAFs within the PCAF histone acetylase complex. Histone-like TAFs within the PCAF histone acetylase complex. Cell (0092-8674) 1998 imex curation Ogryzko VV., Kotani T., Zhang X., Schiltz RL., Howard T., Yang XJ., Howard BH., Qin J., Nakatani Y. Chromatin - Epigenetic interactions resulting in chromatin modulation Results from Figure 6 have not been added to the entries since the proteins identified only by commassie blue staining. HeLa cells expressing FLAG epitope tagged PCAF. Nuclear extract was prepared from the resulting cells and fractionated on S:Sepharose. The epitope tagged PCAF was purified from this fraction by affinity chromatography on anti:FLAG antibody conjugated agarose. The bound polypeptides were eluted with the epitope peptide under native conditions. FLAG:PCAF was further purified by anti:PCAF antibody affinity chromatography. yoshi@helix.nih.gov 27-Aug-2008: Contacted by JYOTI. davet Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ogryzko VV., Kotani T., Zhang X., Schiltz RL., Howard T., Yang XJ., Howard BH., Qin J., Nakatani Y. Chromatin - Epigenetic interactions resulting in chromatin modulation Results from Figure 6 have not been added to the entries since the proteins identified only by commassie blue staining. HeLa cells expressing FLAG epitope tagged PCAF. Nuclear extract was prepared from the resulting cells and fractionated on S:Sepharose. The epitope tagged PCAF was purified from this fraction by affinity chromatography on anti:FLAG antibody conjugated agarose. The bound polypeptides were eluted with the epitope peptide under native conditions. FLAG:PCAF was further purified by anti:PCAF antibody affinity chromatography. yoshi@helix.nih.gov Accepted 2008-AUG-23 by DAVET. 27-Aug-2008: Contacted by JYOTI. Cell (0092-8674) 1998 davet Only protein-protein interactions imex curation taf9_human Transcription initiation factor TFIID subunit 9 Transcription initiation factor TFIID 31 kDa subunit Transcription initiation factor TFIID 32 kDa subunit RNA polymerase II TBP-associated factor subunit G STAF31/32 TAF9 TAF2G TAFII31 protein protein human Homo sapiens Human MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKKASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIGSKNILITTNMMSSQNTANESSNALKRKREDDDDDDDDDDDYDNL DIP protein Q16594 original sequence version: 66 DIP protein Q16594 original sequence version: 105 DIP protein Q16594 original sequence version: 131 1925AEC65D6C84C7 taf6_human Transcription initiation factor TFIID subunit 6 Transcription initiation factor TFIID 70 kDa subunit Transcription initiation factor TFIID 80 kDa subunit RNA polymerase II TBP-associated factor subunit E TAF6 TAF2E TAFII70 protein protein human Homo sapiens Human MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRITKTFTKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEGERIRSVLDGPVLSNIDRIGADHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLCSQVVKARAQAALQAQQVNRTTLTITQPRPTLTLSQAPQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSAPSTQQVLSLSTSAPGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHPSPVPPPASSPSPLSGSALCGGKQEAGDSPPPAPGTPKANGSQPNSGSPQPAP DIP protein P49848 original sequence version: 66 06C6BFA563580823 tbp_human TATA-box-binding protein TBP TF2D TFIID GTF2D1 TATA-box factor TATA-binding factor TATA sequence-binding protein Transcription initiation factor TFIID TBP subunit protein protein human Homo sapiens Human MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT DIP protein P20226 original sequence version: 106 DIP protein P20226 original sequence version: 157 DIP protein P20226 original sequence version: 173 DIP protein P20226 original sequence version: 194 DIP protein P20226 original sequence version: 179 DIP protein P20226 original sequence version: 131 A61A578D972B970B q16514-1 Transcription initiation factor TFIID subunit 12 TAF12 TAF15 TAF2J TAFII20 Transcription initiation factor TFIID 20/15 kDa subunits protein protein human Homo sapiens Human MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK DIP protein Q16514-1 original sequence version: 139 054B017CD7BF99CE supt3_human Transcription initiation protein SPT3 homolog SUPT3H SPT3 SPT3-like protein protein protein human Homo sapiens Human MNNTAASPMSTATSSSGRSTGKSISFATELQSMMYSLGDARRPLHETAVLVEDVVHTQLINLLQQAAEVSQLRGARVITPEDLLFLMRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSNNANKRQKIAQDFLNSIDQTGELLAMFEDDEIDEVKQERMERAERQTRIMDSAQYAEFCESRQLSFSKKASKFRDWLDCSSMEIKPNVVAMEILAYLAYETVAQLVDLALLVRQDMVTKAGDPFSHAISATFIQYHNSAESTAACGVEAHSDAIQPCHIREAIRRYSHRIGPLSPFTNAYRRNGMAFLAC AF339954A57DB5A6 taf5_human Transcription initiation factor TFIID subunit 5 Transcription initiation factor TFIID 100 kDa subunit TAF5 TAF2D protein protein human Homo sapiens Human MAALAEEQTEVAVKLEPEGPPTLLPPQAGDGAGEGSGGTTNNGPNGGGGNVAASSSTGGDGGTPKPTVAVSAAAPAGAAPVPAAAPDAGAPHDRQTLLAVLQFLRQSKLREAEEALRREAGLLEEAVAGSGAPGEVDSAGAEVTSALLSRVTASAPGPAAPDPPGTGASGATVVSGSASGPAAPGKVGSVAVEDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKPKKKKPKKDSIGSKSKKQDPNAPPQNRIPLPELKDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTDDSSLIAGGFADSTVRVWSVTPKKLRSVKQASDLSLIDKESDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ DIP protein Q15542 original sequence version: 141 DIP protein Q15542 original sequence version: 62 DIP protein Q15542 original sequence version: 131 DIP protein Q15542 original sequence version: 152 87A178BFB7071992 tada3_human Transcriptional adapter 3 ADA3 homolog STAF54 TADA3 ADA3 TADA3L Transcriptional adapter 3-like protein protein human Homo sapiens Human MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQILTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVDALLKKSEAQHEQPEDGCPFGALTQRLLQALVEENIISPMEDSPIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELKALSAHNRTKKHDLLRLAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTLKERESILKLLDG C86153CFA83F9226 taf5l_human TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L TAF5L PAF65B PCAF-associated factor 65 beta protein protein human Homo sapiens Human MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEDDEDDNAGTEMKILRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDLDISPYSLYFASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPNGKYLASAGEDQRLKLWDLASGTLYKELRGHTDNITSLTFSPDSGLIASASMDNSVRVWDIRNTYCSAPADGSSSELVGVYTGQMSNVLSVQFMACNLLLVTGITQENQEH DIP protein O75529 original sequence version: 124 BBF0A1CDD17EE22E taf10_human Transcription initiation factor TFIID subunit 10 Transcription initiation factor TFIID 30 kDa subunit STAF28 TAF10 TAF2H TAFII30 TAF2A protein protein human Homo sapiens Human MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGEPAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT DIP protein Q12962 original sequence version: 59 032ED5CA97EBE411 tad2a_human Transcriptional adapter 2-alpha TADA2A TADA2L Transcriptional adapter 2-like KL04P protein protein human Homo sapiens Human MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEIMTSDFPVLDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKHFINNPLFASTLLNLKQAEEAKTADTAIPFHSTDDPPRPTFDSLLSRDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHALEFELRREIKRLQEYRTAGITNFCSARTYDHLKKTREEERLKRTMLSEVLQYIQDSSACQQWLRRQADIDSGLSPSIPMASNSGRRSAPPLNLTGLPGTEKLNEKEKELCQMVRLVPGAYLEYKSALLNECNKQGGLRLAQARALIKIDVNKTRKIYDFLIREGYITKG A4E1D87B1B3F6BA5 taf1_human Transcription initiation factor TFIID subunit 1 TAF1 BA2R CCG1 TAF2A CCGS Transcription initiation factor TFIID 250 kDa subunit TBP-associated factor 250 kDa Cell cycle gene 1 protein protein protein human Homo sapiens Human MGPGCDLLLRTAATITAAAIMSDTDSDEDSAGGGPFSLAGFLFGNINGAGQLEGESVLDDECKKHLAGLGALGLGSLITELTANEELTGTDGALVNDEGWVRSTEDAVDYSDINEVAEDESRRYQQTMGSLQPLCHSDYDEDDYDADCEDIDCKLMPPPPPPPGPMKKDKDQDSITGEKVDFSSSSDSESEMGPQEATQAESEDGKLTLPLAGIMQHDATKLLPSVTELFPEFRPGKVLRFLRLFGPGKNVPSVWRSARRKRKKKHRELIQEEQIQEVECSVESEVSQKSLWNYDYAPPPPPEQCLSDDEITMMAPVESKFSQSTGDIDKVTDTKPRVAEWRYGPARLWYDMLGVPEDGSGFDYGFKLRKTEHEPVIKSRMIEEFRKLEENNGTDLLADENFLMVTQLHWEDDIIWDGEDVKHKGTKPQRASLAGWLPSSMTRNAMAYNVQQGFAATLDDDKPWYSIFPIDNEDLVYGRWEDNIIWDAQAMPRLLEPPVLTLDPNDENLILEIPDEKEEATSNSPSKESKKESSLKKSRILLGKTGVIKEEPQQNMSQPEVKDPWNLSNDEYYYPKQQGLRGTFGGNIIQHSIPAVELRQPFFPTHMGPIKLRQFHRPPLKKYSFGALSQPGPHSVQPLLKHIKKKAKMREQERQASGGGEMFFMRTPQDLTGKDGDLILAEYSEENGPLMMQVGMATKIKNYYKRKPGKDPGAPDCKYGETVYCHTSPFLGSLHPGQLLQAFENNLFRAPIYLHKMPETDFLIIRTRQGYYIRELVDIFVVGQQCPLFEVPGPNSKRANTHIRDFLQVFIYRLFWKSKDRPRRIRMEDIKKAFPSHSESSIRKRLKLCADFKRTGMDSNWWVLKSDFRLPTEEEIRAMVSPEQCCAYYSMIAAEQRLKDAGYGEKSFFAPEEENEEDFQMKIDDEVRTAPWNTTRAFIAAMKGKCLLEVTGVADPTGCGEGFSYVKIPNKPTQQKDDKEPQPVKKTVTGTDADLRRLSLKNAKQLLRKFGVPEEEIKKLSRWEVIDVVRTMSTEQARSGEGPMSKFARGSRFSVAEHQERYKEECQRIFDLQNKVLSSTEVLSTDTDSSSAEDSDFEEMGKNIENMLQNKKTSSQLSREREEQERKELQRMLLAAGSAASGNNHRDDDTASVTSLNSSATGRCLKIYRTFRDEEGKEYVRCETVRKPAVIDAYVRIRTTKDEEFIRKFALFDEQHREEMRKERRRIQEQLRRLKRNQEKEKLKGPPEKKPKKMKERPDLKLKCGACGAIGHMRTNKFCPLYYQTNAPPSNPVAMTEEQEEELEKTVIHNDNEELIKVEGTKIVLGKQLIESADEVRRKSLVLKFPKQQLPPKKKRRVGTTVHCDYLNRPHKSIHRRRTDPMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAINPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAELESLDPMTPGPYTPQPPDLYDTNTSLSMSRDASVFQDESNMSVLDIPSATPEKQVTQEGEDGDGDLADEEEGTVQQPQASVLYEDLLMSEGEDDEEDAGSDEEGDNPFSAIQLSESGSDSDVGSGGIRPKQPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE DIP protein P21675 original sequence version: 92 DIP protein P21675 original sequence version: 149 DIP protein P21675 original sequence version: 172 93BE3D181A72ABEB taf4_human Transcription initiation factor TFIID subunit 4 TAF4 TAF2C TAF2C1 TAF4A TAFII130 TAFII135 TBP-associated factor 4 Transcription initiation factor TFIID 135 kDa subunit Transcription initiation factor TFIID 130 kDa subunit RNA polymerase II TBP-associated factor subunit C protein protein human Homo sapiens Human MAAGSDLLDEVFFNSEVDEKVVSDLVGSLESQLAASAAHHHHLAPRTPEVRAAAAGALGNHVVSGSPAGAAGAGPAAPAEGAPGAAPEPPPAGRARPGGGGPQRPGPPSPRRPLVPAGPAPPAAKLRPPPEGSAGSCAPVPAAAAVAAGPEPAPAGPAKPAGPAALAARAGPGPGPGPGPGPGPGPGKPAGPGAAQTLNGSAALLNSHHAAAPAVSLVNNGPAALLPLPKPAAPGTVIQTPPFVGAAAPPAPAAPSPPAAPAPAAPAAAPPPPPPAPATLARPPGHPAGPPTAAPAVPPPAAAQNGGSAGAAPAPAPAAGGPAGVSGQPGPGAAAAAPAPGVKAESPKRVVQAAPPAAQTLAASGPASTAASMVIGPTMQGALPSPAAVPPPAPGTPTGLPKGAAGAVTQSLSRTPTATTSGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQAHAQPQTTMAPRPATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATLQRSPGVQPQLVLGGAAQTASLGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPPTSQATTALTAVVLSSSVQRTAGKTAATVTSALQPPVLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNPLQPVPVVKPAVLPGTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLLQAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGSGAEGSGPGSVVPGSSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK DIP protein O00268 original sequence version: 153 DIP protein O00268 original sequence version: 139 BC2F5B5F143DB145 q16514-2 Transcription initiation factor TFIID subunit 12 TAF12 TAF15 TAF2J TAFII20 Transcription initiation factor TFIID 20/15 kDa subunits protein protein human Homo sapiens Human MANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK 655B769918311CE1 kat2b_human Histone acetyltransferase KAT2B P300/CBP-associated factor PCAF Lysine acetyltransferase 2B Histone acetyltransferase PCAF KAT2B Spermidine acetyltransferase KAT2B protein protein human Homo sapiens Human MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAAAGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEANPGEKRKMTDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK DIP protein Q92831 original sequence version: 159 DIP protein Q92831 original sequence version: 153 DIP protein Q92831 original sequence version: 84 72F516E8BC00CC0C taf6l_human TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L PCAF-associated factor 65-alpha TAF6L PAF65A protein protein human Homo sapiens Human MSEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQNSSQFMKHTKRRKLTVEDFNRALRWSSVEAVCGYGSQEALPMRPAREGELYFPEDREVNLVELALATNIPKGCAETAVRVHVSYLDGKGNLAPQGSVPSAVSSLTDDLLKYYHQVTRAVLGDDPQLMKVALQDLQTNSKIGALLPYFVYVVSGVKSVSHDLEQLHRLLQVARSLFRNPHLCLGPYVRCLVGSVLYCVLEPLAASINPLNDHWTLRDGAALLLSHIFWTHGDLVSGLYQHILLSLQKILADPVRPLCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYGAILVAVERLLKMKAQAAEPNRGGPGGRGCRRLDDLPWDSLLFQESSSGGGAEPSFGSGLPLPPGGAGPEDPSLSVTLADIYRELYAFFGDSLATRFGTGQPAPTAPRPPGDKKEPAAAPDSVRKMPQLTASAIVSPHGDESPRGSGGGGPASASGPAASESRPLPRVHRARGAPRQQGPGTGTRDVFQKSRFAPRGAPHFRFIIAGRQAGRRCRGRLFQTAFPAPYGPSPASRYVQKLPMIGRTSRPARRWALSDYSLYLPL F294E71AF7D4C8C3 pcaf-gcn5-1 2 8 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 19 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain association association 3, 4, 7 and Table 2 pcaf-tafii31 3 5 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait physical association physical association 7 While anti-PCAF antibody coprecipitated hTAFII31 along with PCAF, neither anti-p300 nor anti-CBP antibody coprecipitated hTAFII31 pcaf-tbp 4 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey association association 4 PCAF complex has a subset of histone-like TAFs, namely, hTAFII31, hTAFII20, and hTAFII15 tfiid-tbp-1 4 15 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association 4 paf65-tafii31 1 5 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 5C paf65-tafii31-1 1 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 5C