IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ MIDGET unravels functions of the Arabidopsis topoisomerase VI complex in DNA endoreduplication, chromatin condensation, and transcriptional silencing. MIDGET unravels functions of the Arabidopsis topoisomerase VI complex in DNA endoreduplication, chromatin condensation, and transcriptional silencing. Plant Cell (1040-4651) 2007 Kirik V., Schrader A., Uhrig JF., Hulskamp M. Chromatin - Epigenetic interactions resulting in chromatin modulation Although the authors do not provide details of which tags were fused to which proteins , and did not respond to email requests; I curated this paper as it is the only example of the MIDGET protein interacting with other proteins in the current literature. This study used plant protoplasts. vkirik@stanford.edu 25-Jun-2008: Contacted by JYOTI. jyoti arath-leaf Arabidopsis thaliana leaf leaf leaf bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Kirik V., Schrader A., Uhrig JF., Hulskamp M. Chromatin - Epigenetic interactions resulting in chromatin modulation Although the authors do not provide details of which tags were fused to which proteins , and did not respond to email requests; I curated this paper as it is the only example of the MIDGET protein interacting with other proteins in the current literature. This study used plant protoplasts. vkirik@stanford.edu Accepted 2008-JUL-6 by JYOTI. 25-Jun-2008: Contacted by JYOTI. Plant Cell (1040-4651) 2007 jyoti MIDGET unravels functions of the Arabidopsis topoisomerase VI complex in DNA endoreduplication, chromatin condensation, and transcriptional silencing. MIDGET unravels functions of the Arabidopsis topoisomerase VI complex in DNA endoreduplication, chromatin condensation, and transcriptional silencing. Plant Cell (1040-4651) 2007 Kirik V., Schrader A., Uhrig JF., Hulskamp M. Chromatin - Epigenetic interactions resulting in chromatin modulation Although the authors do not provide details of which tags were fused to which proteins , and did not respond to email requests; I curated this paper as it is the only example of the MIDGET protein interacting with other proteins in the current literature. This study used plant protoplasts. vkirik@stanford.edu 25-Jun-2008: Contacted by JYOTI. jyoti arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kirik V., Schrader A., Uhrig JF., Hulskamp M. Chromatin - Epigenetic interactions resulting in chromatin modulation Although the authors do not provide details of which tags were fused to which proteins , and did not respond to email requests; I curated this paper as it is the only example of the MIDGET protein interacting with other proteins in the current literature. This study used plant protoplasts. vkirik@stanford.edu Accepted 2008-JUL-6 by JYOTI. Plant Cell (1040-4651) 2007 jyoti top6a_arath DNA topoisomerase 6 subunit A TOP6A SPO11-3 BIN5 At5g02820 RHL2 Protein BRASSINOSTEROID INSENSITIVE 5 Protein ROOT HAIRLESS 2 Meiotic recombination protein SPO11-3 F9G14.130 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADKKKRKRSKDDEAEELPFKSILESDDVITELLKSYISSSIKAAAGAGGASSSSSKPLTLADLSLSSSCREVADLSLSSVQTEIETVIVQIARSILAGDGFSFSVPSRAASNQLYVPELDRIVLKDKSTLRPFASVSSVRKTTITTRILALIHQLCLRNIHVTKRDLFYTDVKLFQDQTQSDAVLDDVSCMLGCTRSSLNVIAAEKGVVVGRLIFSDNGDMIDCTKMGMGGKAIPPNIDRVGDMQSDAMFILLVEKDAAYMRLAEDRFYNRFPCIIVTAKGQPDVATRLFLRKMKMELKLPVLALVDSDPYGLKILSVYGCGSKNMSYDSANLTTPDIKWLGIRPSDLDKYKIPEQCRLPMTEQDIKTGKDMLEEDFVKKNPGWVEELNLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQQQDWL DIP protein Q9LZ03 original sequence version: 105 0EA41B8B4BA77441 rhl1_arath DNA-binding protein RHL1 RHL1 HYP7 At1g48380 Protein ROOT HAIRLESS 1 Protein ELONGATED HYPOCOTYL 7 F11A17.7 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVRASSSKKGGSKGGDKDDAESKQRKRLKTLALDNQLLSDSPAKSHSSLKPSKQVLKHHGTDIIRKSQRKNRFLFSFPGLLAPISAATIGDLDRLSTKNPVLYLNFPQGRMKLFGTILYPKNRYLTLQFSRGGKNVLCDDYFDNMIVFSESWWIGTKEENPEEARLDFPKELAQAENTEFDFQGGAGGAASVKKLASPEIGSQPTETDSPEVDNEDVLSEDGEFLDDKIQVTPPVQLTPPVQVTPVRQSQRNSGKKFNFAETSSEASSGESEGNTSDEDEKPLLEPESSTRSREESQDGNGITASASKLPEELPAKREKLKSKDSKLVQATLSNLFKKAEEKTAGTSKAKSSSKA D0B2EA050D5095BA bin4_arath DNA-binding protein BIN4 At5g24630 BIN4 MID Protein BRASSINOSTEROID INSENSITIVE 4 Protein MIDGET K18P6.17 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSSREGSPDWLRSYEAPMTTSLLSLSSSDDDSPYRESEVISSLPLPDDDGDDIVVLETESVELLTRKNSETKVVTKQVSIEQVFSRKKKADASLNLEDSCAGKENGNNVDCEKLSSKHKDAQGGADSVWLVSSDSEPSSPIKQEVTVSTEKDADFVLEATEEEPAVKTVRKEKSPKTKSKSSRKTPKEGNSAQEILKTEDKDTDTTIAEQVTPEKSPKTKSKSSRKTPKEENCAQEILKTEDKDKDTDTDTIIAEEVTTDQKIKPSSGSSSRLPLVLSEKVNRTKVLVECEGDSIDLSGDMGAVGRVVVSDTTGDMYLDLKGTIYKSTIIPSRTFCVVNVGQTEAKIEAIMNDFIQLIPQSNVYEAETMVEGTLEGFTFESDDESNKNAKTAVKPADQSVGTEEETNTKAKPKAKAKGETVIGKKRGRPSKEKQPPAKKARNSAPKKPKAKK 022EC68551BA5362 rhl1-rhl2 2 4 unspecified role unspecified role prey prey region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 4G we found that HA-RHL2 protein was immunoprecipitated with anti-GFP beads and RHL1-CFP with anti-HA beads from the plants harboring the 35S:RHL1-CFP and 35S:HA-RHL2 constructs BAIT: At5g02820/F9G14_130 is RLH2 rhl1-midget-1 1 4 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The authors do not state which tag (n-terminal YFP or c-terminal yfp) was fused to which protein. The use of the annotation 'tag' reflects this omission of information. Figure 4F we cotransformed plasmids encoding BiFC fusion constructs of the two proteins with the N- or C-terminal part of YFP into Arabidopsis protoplasts. A restored YFP fluorescence was localized in the nuclei of transfected protoplasts, suggesting that MID and RHL1 can interact in planta The authors state that a " restored YFP fluorescence was localized in the nuclei of transfected protoplasts". Polyethylene glycol transformation of protoplasts.