DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis of the recognition of a methylated histone tail by JMJD2A. Structural basis of the recognition of a methylated histone tail by JMJD2A. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 imex curation Chen Z., Zang J., Kappler J., Hong X., Crawford F., Wang Q., Lan F., Jiang C., Whetstine J., Dai S., Hansen K., Shi Y., Zhang G. Chromatin - Epigenetic interactions resulting in chromatin modulation Demethylation of H3k9Me3 and H3k36Me3 studied by maldi-tof. zhangg@njc.org orchard Only protein-protein interactions in vitro In vitro demethylase assay demethylase assay ms participant Identification by mass spectrometry ms participant Chen Z., Zang J., Kappler J., Hong X., Crawford F., Wang Q., Lan F., Jiang C., Whetstine J., Dai S., Hansen K., Shi Y., Zhang G. Chromatin - Epigenetic interactions resulting in chromatin modulation Demethylation of H3k9Me3 and H3k36Me3 studied by maldi-tof. zhangg@njc.org zhangg@njc.org. Accepted 2007-AUG-5 by ORCHARD. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 orchard IMEx Structural basis of the recognition of a methylated histone tail by JMJD2A. Structural basis of the recognition of a methylated histone tail by JMJD2A. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 imex curation Chen Z., Zang J., Kappler J., Hong X., Crawford F., Wang Q., Lan F., Jiang C., Whetstine J., Dai S., Hansen K., Shi Y., Zhang G. Chromatin - Epigenetic interactions resulting in chromatin modulation Demethylation of H3k9Me3 and H3k36Me3 studied by maldi-tof. zhangg@njc.org orchard Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Chen Z., Zang J., Kappler J., Hong X., Crawford F., Wang Q., Lan F., Jiang C., Whetstine J., Dai S., Hansen K., Shi Y., Zhang G. Chromatin - Epigenetic interactions resulting in chromatin modulation Demethylation of H3k9Me3 and H3k36Me3 studied by maldi-tof. zhangg@njc.org zhangg@njc.org. Accepted 2007-AUG-5 by ORCHARD. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 orchard IMEx Structural basis of the recognition of a methylated histone tail by JMJD2A. Structural basis of the recognition of a methylated histone tail by JMJD2A. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 imex curation Chen Z., Zang J., Kappler J., Hong X., Crawford F., Wang Q., Lan F., Jiang C., Whetstine J., Dai S., Hansen K., Shi Y., Zhang G. Chromatin - Epigenetic interactions resulting in chromatin modulation Demethylation of H3k9Me3 and H3k36Me3 studied by maldi-tof. zhangg@njc.org orchard Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chen Z., Zang J., Kappler J., Hong X., Crawford F., Wang Q., Lan F., Jiang C., Whetstine J., Dai S., Hansen K., Shi Y., Zhang G. Chromatin - Epigenetic interactions resulting in chromatin modulation Demethylation of H3k9Me3 and H3k36Me3 studied by maldi-tof. zhangg@njc.org zhangg@njc.org. Accepted 2007-AUG-5 by ORCHARD. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 orchard IMEx h31t_human Histone H3.1t H3-4 H3/g H3FT HIST3H3 Histone H3.4 protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA DIP protein Q16695 original sequence version: 117 37375A2C3A377B2B kdm4a_human Lysine-specific demethylase 4A KDM4A JMJD2 KIAA0677 Jumonji domain-containing protein 2A JHDM3A [histone H3]-trimethyl-L-lysine(36) demethylase 4A [histone H3]-trimethyl-L-lysine(9) demethylase 4A JMJD2A JmjC domain-containing histone demethylation protein 3A protein protein human Homo sapiens Human MASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLKESELPPRAGNEEECPEEDMEGVEDGEEGDLKTSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDLSSEQYEMTECPAALAPVRPTHSSVRQVEDGLTFPDYSDSTEVKFEELKNVKLEEEDEEEEQAAAALDLSVNPASVGGRLVFSGSKKKSSSSLGSGSSRDSISSDSETSEPLSCRAQGQTGVLTVHSYAKGDGRVTVGEPCTRKKGSAARSFSERELAEVADEYMFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNETMAQQAPHCAVCMIFQTYHQVEFGGFNQNCGNASDLAPQKQRTKPLIPEMCFTSTGCSTDINLSTPYLEEDGTSILVSCKKCSVRVHASCYGVPPAKASEDWMCSRCSANALEEDCCLCSLRGGALQRANDDRWVHVSCAVAILEARFVNIAERSPVDVSKIPLPRFKLKCIFCKKRRKRTAGCCVQCSHGRCPTAFHVSCAQAAGVMMQPDDWPFVVFITCFRHKIPNLERAKGALQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELPKRVKSRLSVASDMRFNEIFTEKEVKQEKKRQRVINSRYREDYIEPALYRAIME 4A811BEECFEDC6B3 jhd3a-h3_pep-3 1 4 unspecified role unspecified role neutral component neutral component lys36 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component O75164:p.Asn86Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain N A Wed May 02 19:33:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn86ala' Tue Jun 30 16:31:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn86Ala' O75164:p.Gln88Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Q A Wed May 02 15:53:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln88ala' Tue Jun 30 19:42:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln88Ala' O75164:p.Asp135Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A Wed May 02 16:26:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp135ala' Tue Jun 30 20:15:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp135Ala' O75164:p.Tyr175Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 15:34:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr175phe' Tue Jun 30 19:36:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr175Phe' O75164:p.Tyr177Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 14:46:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr177phe' Tue Jun 30 16:14:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr177Phe' O75164:p.Lys241Leu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K L Wed May 02 14:39:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys241leu' Tue Jun 30 19:28:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys241Leu' O75164:p.Tyr177Leu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y L Wed May 02 17:48:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr177leu' Tue Jun 30 19:31:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr177Leu' O75164:p.Lys241Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K A Wed May 02 15:29:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys241ala' Tue Jun 30 18:20:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys241Ala' O75164:p.Asn290Val mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain N V Wed May 02 16:28:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn290val' Tue Jun 30 17:10:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn290Val' O75164:p.Asn290Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain N A Wed May 02 19:58:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn290ala' Tue Jun 30 15:36:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn290Ala' O75164:p.Asn290Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain N D Wed May 02 16:03:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn290asp' Tue Jun 30 17:14:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn290Asp' O75164:p.Asn290Ile mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain N I Wed May 02 18:47:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn290ile' Tue Jun 30 17:42:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn290Ile' ecoli Escherichia coli (strain K12) demethylation demethylation reaction demethylation The detailed interaction between c-JMJD2A and the methylated peptides. 2 revisit when demethylase term in IntAct CV Mutagenesis data and activity assays suggest residues Q86, N88, D135, and Y175 are involved in the interaction with the peptide, whereas residues Y177, N290, S288, and T289 are involved in methyl group binding. K241 is proposed to recruit the O2 molecule into the catalytic center. jhd3a-h3_pep-1 3 4 unspecified role unspecified role neutral component neutral component lys36 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction working 25.6%, free 27.6% 2.00 A Table S1, Figure 1 The overall complex structure of c-JMJD2A with the H3K36me3 peptide jhd3a-h3_pep-2 3 4 unspecified role unspecified role neutral component neutral component lys36 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q16695:p.Ala48Lys mutation mutation certain certain sequence position certain certain certain sequence position certain A K Wed May 02 16:02:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala48lys' Tue Jun 30 20:22:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala48Lys' chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction working 23.8%, free 26.3% 1.99 A crystals of the complex of c-JMJD2A with a trimethylated H3K36 peptide were obtained Table 1, Figure 1 Peptide is Lys is position 48 of the protein, whereas UniProt has Ala at this position. jhd3a-h3_pep-4 1 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain lys9 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component O75164:p.Asn86Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain N A Wed May 02 15:40:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn86ala' Tue Jun 30 18:22:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn86Ala' O75164:p.Gln88Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Q A Wed May 02 16:26:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln88ala' Tue Jun 30 18:21:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln88Ala' O75164:p.Asp135Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A Wed May 02 14:36:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp135ala' Tue Jun 30 19:14:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp135Ala' O75164:p.Tyr175Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 18:42:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr175phe' Tue Jun 30 17:57:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr175Phe' O75164:p.Tyr177Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 15:43:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr177phe' Tue Jun 30 17:34:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr177Phe' O75164:p.Lys241Leu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K L Wed May 02 18:10:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys241leu' Tue Jun 30 19:26:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys241Leu' O75164:p.Tyr177Leu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y L Wed May 02 18:55:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr177leu' Tue Jun 30 18:18:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr177Leu' O75164:p.Lys241Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K A Wed May 02 19:34:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys241ala' Tue Jun 30 18:16:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys241Ala' O75164:p.Asn290Val mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain N V Wed May 02 18:56:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn290val' Tue Jun 30 15:46:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn290Val' O75164:p.Asn290Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain N A Wed May 02 17:40:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn290ala' Tue Jun 30 17:07:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn290Ala' O75164:p.Asn290Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain N D Wed May 02 15:30:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn290asp' Tue Jun 30 17:05:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn290Asp' O75164:p.Asn290Ile mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain N I Wed May 02 16:40:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn290ile' Tue Jun 30 19:15:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn290Ile' ecoli Escherichia coli (strain K12) demethylation demethylation reaction demethylation The detailed interaction between c-JMJD2A and the methylated peptides. 2 revisit when demethylase term in IntAct CV Mutagenesis data and activity assays suggest residues Q86, N88, D135, and Y175 are involved in the interaction with the peptide, whereas residues Y177, N290, S288, and T289 are involved in methyl group binding. K241 is proposed to recruit the O2 molecule into the catalytic center. jhd3a-h3_pep-5 2 4 unspecified role unspecified role bait bait lys36 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction We used surface plasmon resonance to further analyze the binding of c-JMJD2A to H3K9me3 and H3K36me3. 2C jhd3a-h3_pep-6 2 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain lys9 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O75164:p.[Gly133Ala;Gly138Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G A certain certain sequence position certain certain certain sequence position certain G A Fri Jun 30 14:26:55 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'gly133ala,gla138ala' Wed May 02 14:53:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly133ala,gly138ala' Tue Jun 30 18:41:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly133Ala;Gly138Ala]' O75164:p.[Gly165Ala;Gly170Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G A certain certain sequence position certain certain certain sequence position certain G A Wed May 02 16:16:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly165ala,gly170ala' Tue Jun 30 15:37:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly165Ala;Gly170Ala]' ecoli Escherichia coli (strain K12) direct interaction direct interaction We used surface plasmon resonance to further analyze the binding of c-JMJD2A to H3K9me3 and H3K36me3. 2D