IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The cell-cycle regulator geminin inhibits Hox function through direct and polycomb-mediated interactions. The cell-cycle regulator geminin inhibits Hox function through direct and polycomb-mediated interactions. Nature (0028-0836) 2004 Luo L., Yang X., Takihara Y., Knoetgen H., Kessel M. Chromatin - Epigenetic interactions resulting in chromatin modulation 8.5 dpc mouse cDNA library used for screening. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Luo L., Yang X., Takihara Y., Knoetgen H., Kessel M. Chromatin - Epigenetic interactions resulting in chromatin modulation Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). 8.5 dpc mouse cDNA library used for screening. Nature (0028-0836) 2004 The cell-cycle regulator geminin inhibits Hox function through direct and polycomb-mediated interactions. The cell-cycle regulator geminin inhibits Hox function through direct and polycomb-mediated interactions. Nature (0028-0836) 2004 Luo L., Yang X., Takihara Y., Knoetgen H., Kessel M. Chromatin - Epigenetic interactions resulting in chromatin modulation 8.5 dpc mouse cDNA library used for screening. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down predetermined predetermined participant predetermined Luo L., Yang X., Takihara Y., Knoetgen H., Kessel M. Chromatin - Epigenetic interactions resulting in chromatin modulation Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). 8.5 dpc mouse cDNA library used for screening. Nature (0028-0836) 2004 gemi_mouse Geminin Gmnn protein protein mouse Mus musculus Mouse MNLSMKQKQEGAQENVKNSPVPRRTLKMIQPSADGSLVGRENELPKGLFKRKLWDDQLASQTSSCGPEANENKDVGDLTQEAFDLISKENPSSQYWKEVAEQRRKALYEALKENEKLHKEIEQKDSEIARLRKENKDLAEVAEHVQYMAEVIERLSNEPLDNFESPDSQEFDSEEEAVEYSELEDSGAGTCAEETVSSSTDARPCT DIP protein O88513 original sequence version: 112 DIP protein O88513 original sequence version: 104 B87153A5D5BCF5CF hxa7_mouse Homeobox protein Hox-A7 Homeobox protein Hox-1.1 Hoxa7 Hox-1.1 Hoxa-7 Homeobox protein M6-12 protein protein mouse Mus musculus Mouse MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGPGAGAFASTVPGLYNVNSPLYQSPFASGYGLGADAYNLPCASYDQNIPGLCSDLAKGACDKADEGVLHGPAEASFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKDESQAPTAAPEDAVPSVSTAADKADEEEEEEEEEEEEEEE D36E6BD61D8D5C6F hxd10_mouse Homeobox protein Hox-D10 Homeobox protein Hox-4.5 Hoxd10 Hox-4.5 Hoxd-10 Homeobox protein Hox-5.3 protein protein mouse Mus musculus Mouse MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTANIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNESASGQEPTKVSQVESPEAKGGLPEDRSCLAEVSVSSPEVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS 974ABDB417F9F90D scmh1_mouse Polycomb protein SCMH1 Sex comb on midleg homolog 1 Scmh1 protein protein mouse Mus musculus Mouse MLVCYSVLACESLWDLPCSIMGSPLGHFTWDKYLKETCSVPAPVHCFKQSYTPPSNEFKISMKLEAQDPRNTTSTCIATVVGLTGARLRLRLDGSDNKNDFWRLVDSSEIQPIGNCEKNGGMLQPPLGFRLNASSWPMFLLKTLNGAEMAPIKIFHKEPPSPSHNFFKMGMKLEAVDRKNPHFICPATIGEVRGAEVLVTFDGWRGAFDYWCRFDSRDIFPVGWCSLTGDNLQPPGTKVVIPKNPSPSSDVSTEKPSIHSTKTVLEHQPGQRGRKPGKKRGRTPKILIPHPTSTPSKSAEPLKFPKKRGPKPGSKRKPRTLLSPPPTSPTTSTPEPDTSTVPQDAATVPSSAMQAPTVCIYLNKSGSTGPHLDKKKIQQLPDHFGPARASVVLQQAVQACIDCAYHQKTVFSFLKQGHGGEVISAVFDREQHTLNLPAVNSITYVLRFLEKLCHNLRSDNLFGNQPFTQTHLSLTATEYNHNHDRYLPGETFVLGNSLARSLETHSDLMDSALKPANLVSTSQNLRTPGYRPLLPSCGLPLSTVSAVRRLCSKGVLKGKKERRDVESFWKLNHSPGSDRHLESRDPPRLSGRDPSSWTVEDVMQFVREADPQLGSHADLFRKHEIDGKALLLLRSDMMMKYMGLKLGPALKLSFHIDRLKQVFWKRETILWSREGLSREVWPISEDTALGHFFSGMDKVFGSLSKR CC7531B46A439E39 hxc8_mouse Homeobox protein Hox-C8 Homeobox protein Hox-3.1 Hoxc8 Hox-3.1 Hoxc-8 Homeobox protein M31 protein protein mouse Mus musculus Mouse MSSYFVNPLFSKYKGGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENKD 4A2A53BDA4CFA878 hxa11_mouse Homeobox protein Hox-A11 Hoxa11 Hox-1.9 Hoxa-11 Homeobox protein Hox-1.9 protein protein mouse Mus musculus Mouse MMDFDERGPCSSNMYLPSCTYYVSGPDFSSLPSFLPQTPSSRPMTYSYSSNLPQVQPVREVTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAFDQFFETAYGTPENLASSDYPGDKNAEKGPQAAAATSAAAVAAAATGAPATSSSDGGGGGGCQEAAAEEKERRRRPESSSSPESSSGHTEDKAGGSGGQRTRKKRCPYTKYQIRELEREFFFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKINRDRLQYYSANPLL 07BE80F8E2225B3E hxb7_mouse Homeobox protein Hox-B7 Homeobox protein Hox-2.3 Homeobox protein MH-22B Hoxb7 Hox-2.3 Hoxb-7 Homeobox protein MuB1 protein protein mouse Mus musculus Mouse MSSLYYANALFSKYPAASSVFAPGAFPEQTSCAFASNPQRPGYGAGPGAPFSASVQGLYSGGGAMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDPAKAAGAKEQRDSDLAAESNFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTSGPGTTGQDKAEAEEEEEE 074AEB9D57EE88D7 hxa10_mouse Homeobox protein Hox-A10 Hoxa10 Hox-1.8 Hoxa-10 Homeobox protein Hox-1.8 protein protein mouse Mus musculus Mouse MSARKGYLLPSPNYPTTMSCSESPAANSFLVDSLISSGRGEAGVGGGSAGGGGGGYYAHGGVYLPPASDLPYGLQSCGLFPALGSKRNEAPSPGGGGGGGSGGLGPGTHGYAPAPLDLWLDAPRSCRMEPPDGPPPPQPQPQQQQQQPPPPPPQPPQPQPQATSCSFAQNIKEESSYCLYDAADKCPKGSAAADLAPFPRGPPPDGCALGASSGVPVPGYFRLSQAYGTAKGFGSGGGGTQQLASPFPAQPPGRGFDPPPALASGSTEAAGKERVLDSTPPPTLVCTGGGGSQGDEEAHASSSAAEELSPAPSENSKASPEKDSLGSSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS A088014205877F3E hxc9_mouse Homeobox protein Hox-C9 Hoxc9 Hox-3.2 Hoxc-9 Homeobox protein Hox-3.2 protein protein mouse Mus musculus Mouse MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDFPSCSFAPKPAVFSTSWAPVPSQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAYPGRRADCGPGDGRSYPDYMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQS 0A978FF948F5BCAE geminin-hoxd10-1 1 3 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association geminin-hoxa11-1 1 3 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association geminin-scmh1-1 1 6 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association geminin-hoxd10-2 2 5 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association geminin-hoxa11-2 2 8 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association geminin-scmh1-2 2 6 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association geminin-hoxa7 2 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association geminin-hoxb7-1 2 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association geminin-hoxc8-1 2 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association geminin-hoxc9-1 2 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association geminin-hoxa10-1 2 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association