IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A 1-megadalton ESC/E(Z) complex from Drosophila that contains polycomblike and RPD3. A 1-megadalton ESC/E(Z) complex from Drosophila that contains polycomblike and RPD3. Mol. Cell. Biol. (0270-7306) 2003 Tie F., Prasad-Sinha J., Birve A., Rasmuson-Lestander A., Harte PJ. Chromatin - Epigenetic interactions resulting in chromatin modulation 0-16 hour whole embryo extracts used for CoIP drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Tie F., Prasad-Sinha J., Birve A., Rasmuson-Lestander A., Harte PJ. Chromatin - Epigenetic interactions resulting in chromatin modulation 0-16 hour whole embryo extracts used for CoIP Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell. Biol. (0270-7306) 2003 A 1-megadalton ESC/E(Z) complex from Drosophila that contains polycomblike and RPD3. A 1-megadalton ESC/E(Z) complex from Drosophila that contains polycomblike and RPD3. Mol. Cell. Biol. (0270-7306) 2003 Tie F., Prasad-Sinha J., Birve A., Rasmuson-Lestander A., Harte PJ. Chromatin - Epigenetic interactions resulting in chromatin modulation 0-16 hour whole embryo extracts used for CoIP drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tie F., Prasad-Sinha J., Birve A., Rasmuson-Lestander A., Harte PJ. Chromatin - Epigenetic interactions resulting in chromatin modulation 0-16 hour whole embryo extracts used for CoIP Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell. Biol. (0270-7306) 2003 A 1-megadalton ESC/E(Z) complex from Drosophila that contains polycomblike and RPD3. A 1-megadalton ESC/E(Z) complex from Drosophila that contains polycomblike and RPD3. Mol. Cell. Biol. (0270-7306) 2003 Tie F., Prasad-Sinha J., Birve A., Rasmuson-Lestander A., Harte PJ. Chromatin - Epigenetic interactions resulting in chromatin modulation 0-16 hour whole embryo extracts used for CoIP drome-salivary_gland Drosophila melanogaster Salivary gland salivary_gland Salivary gland imaging technique imaging technique microscopy immunostaining immunostaining Tie F., Prasad-Sinha J., Birve A., Rasmuson-Lestander A., Harte PJ. Chromatin - Epigenetic interactions resulting in chromatin modulation 0-16 hour whole embryo extracts used for CoIP Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell. Biol. (0270-7306) 2003 A 1-megadalton ESC/E(Z) complex from Drosophila that contains polycomblike and RPD3. A 1-megadalton ESC/E(Z) complex from Drosophila that contains polycomblike and RPD3. Mol. Cell. Biol. (0270-7306) 2003 Tie F., Prasad-Sinha J., Birve A., Rasmuson-Lestander A., Harte PJ. Chromatin - Epigenetic interactions resulting in chromatin modulation 0-16 hour whole embryo extracts used for CoIP drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Tie F., Prasad-Sinha J., Birve A., Rasmuson-Lestander A., Harte PJ. Chromatin - Epigenetic interactions resulting in chromatin modulation 0-16 hour whole embryo extracts used for CoIP Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell. Biol. (0270-7306) 2003 A 1-megadalton ESC/E(Z) complex from Drosophila that contains polycomblike and RPD3. A 1-megadalton ESC/E(Z) complex from Drosophila that contains polycomblike and RPD3. Mol. Cell. Biol. (0270-7306) 2003 Tie F., Prasad-Sinha J., Birve A., Rasmuson-Lestander A., Harte PJ. Chromatin - Epigenetic interactions resulting in chromatin modulation 0-16 hour whole embryo extracts used for CoIP in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Tie F., Prasad-Sinha J., Birve A., Rasmuson-Lestander A., Harte PJ. Chromatin - Epigenetic interactions resulting in chromatin modulation 0-16 hour whole embryo extracts used for CoIP Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell. Biol. (0270-7306) 2003 A 1-megadalton ESC/E(Z) complex from Drosophila that contains polycomblike and RPD3. A 1-megadalton ESC/E(Z) complex from Drosophila that contains polycomblike and RPD3. Mol. Cell. Biol. (0270-7306) 2003 Tie F., Prasad-Sinha J., Birve A., Rasmuson-Lestander A., Harte PJ. Chromatin - Epigenetic interactions resulting in chromatin modulation 0-16 hour whole embryo extracts used for CoIP in vitro In vitro pull down pull down predetermined predetermined participant predetermined Tie F., Prasad-Sinha J., Birve A., Rasmuson-Lestander A., Harte PJ. Chromatin - Epigenetic interactions resulting in chromatin modulation 0-16 hour whole embryo extracts used for CoIP Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell. Biol. (0270-7306) 2003 caf1_drome Chromatin assembly factor 1 p55 subunit Caf1-55 CAF-1 Caf1 Nucleosome-remodeling factor 55 kDa subunit CG4236 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVDRSDNAAESFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDAQFDGSHYDNEKGEFGGFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPEIPASELETNTA DIP protein Q24572 original sequence version: 142 DIP protein Q24572 original sequence version: 124 90C5FB959F1660D5 hdac1_drome Histone deacetylase HDAC1 HDAC1 Rpd3 CG7471 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQSHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDEYVRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGGYTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQAIPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRSYKGQRKRPRLDKDTNSNKASSETSSEIKDEKEKGDGADGEESTASNTNSNNNSNNKSDNDAGATANAGSGSGSGSGAGAKGAKENNI DIP protein Q94517 original sequence version: 67 B0F6503D42A1BCE9 ez_drome Histone-lysine N-methyltransferase E(z) KMT6 E(z) CG6502 Protein enhancer of zeste Lysine N-methyltransferase 6 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNSTKVPPEWKRRVKSEYIKIRQQKRYKRADEIKEAWIRNWDEHNHNVQDLYCESKVWQAKPYDPPHVDCVKRAEVTSYNGIPSGPQKVPICVINAVTPIPTMYTWAPTQQNFMVEDETVLHNIPYMGDEVLDKDGKFIEELIKNYDGKVHGDKDPSFMDDAIFVELVHALMRSYSKELEEAAPGTATAIKTETLAKSKQGEDDGVVDVDADGESPMKLEKTDSKGDLTEVEKKETEEPLETEDADVKPDVEEVKDKLPFPAPIIFQAISANFPDKGTAQELKEKYIELTEHQDPERPQECTPNIDGIKAESVSRERTMHSFHTLFCRRCFKYDCFLHRLQGHAGPNLQKRRYPELKPFAEPCSNSCYMLIDGMKEKLAADSKTPPIDSCNEASSEDSNDSNSQFSNKDFNHENSKDNGLTVNSAAVAEINSIMAGMMNITSTQCVWTGADQALYRVLHKVYLKNYCAIAHNMLTKTCRQVYEFAQKEDAEFSFEDLRQDFTPPRKKKKKQRLWSLHCRKIQLKKDSSSNHVYNYTPCDHPGHPCDMNCSCIQTQNFCEKFCNCSSDCQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCQACGADQFKLTKITCKNVCVQRGLHKHLLMAPSDIAGWGIFLKEGAQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSINPNCYAKVMMVTGDHRIGIFAKRAIQPGEELFFDYRYGPTEQLKFVGIEREMEIV 022360ED7772EB60 suz12_drome Polycomb protein Su(z)12 Su(z)12 CG8013 Suppressor 12 of zeste protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAPAKKREKDSNPDGSAANGIIGLTHGAPDASNAGSTVPPTAEGQVKLNGHQQEQELFLQAFEKPTQIYRYLRNRHETNPIFLNRTLSYMKERMSRNNKKRISFQVNSMLESITQKSEAVSQNYLHVIYDSLHEKLPARLDNESGEDLLQEQLLCEAGESVSVETTLYKITRSKRKDSTLDFQELLSKCSQIVYNPKDRVGEHATISIPLQTMRPMGEQHTLYKLLFRIKVLSPSTCNDENAETPPNKRSRPNEKMFGSELILYEKSSGFITEGEYEAMLQPLNSTSIKSFSPKKCTWETMPDSYIPLSLTYDVYQQSPMLKFHLTLSNEQLPEMISAPELQRYVQHLDAVAEMNYNNNNYNNNNNCSGLKNGSGGGNSTVCKTTPEHIQIVYNFMYSNNTRQQTEYTQELNCPWCGLDCLRLYALLKHLKLCHARFNFTYQPAGSGARIDVTINDAYDGSYAGSPYDLAGPSGSSFARTCGPVRRTSVTSLMVCRPRRQKTCLDEFLELDEDEISNQRSYITGHNRLYHHTETCLPVHPKELDIDSEGESDPLWLRQKTIQMIDEFSDVNEGEKELMKLWNLHVMRHGFVGDCQLPIACEMFLDAKGTEIVRKNLYRNFILHMCSLFDYGLIAAETVYKTVQKLQGLLSKYAAGQELMQRQREEQLKYWLDVGMHKKQEDPKTLKSPQKPAPPADQASTSSASTSGSGSGSSSMQPPKRMPAHLKRGSAASSPGVQSKGTENGTNGSNSSSSNSKNVAKKSADQPLSTLANTRERRSEYGQKRNVSGSRLAATPASKRKLSSKDNTVLNKRQRYSDGSPGTGIGNGHGGGSGSGANRNKSNNHSLPATSNNASSSSSNSKRAIARRRSTSERTKASGSTGGGAGGVRTRLSVPAKYERR 53BA0D83C49EC92F esc_drome Polycomb protein esc esc CG14941 Protein extra sex combs protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSSDKVKNGNEPEESEESCGDESASYTTNSTTSRSKSPSSSTRSKRRGRRSTKSKPKSRAAYKYDTHVKENHGANIFGVAFNTLLGKDEPQVFATAGSNRVTVYECPRQGGMQLLHCYADPDPDEVFYTCAWSYDLKTSSPLLAAAGYRGVIRVIDVEQNEAVGNYIGHGQAINELKFHPHKLQLLLSGSKDHAIRLWNIQSHVCIAILGGVEGHRDEVLSIDFNMRGDRIVSSGMDHSLKLWCLNTPEFHHKIELSNTFSQEKSTLPFPTVTKHFPDFSTRDIHRNYVDCVQWFGNFVLSKSCENAIVCWKPGQLHQSFEQVKPSDSSCTIIAEFEYDECEIWFVRFGFNPWQKVIALGNQQGKVYVWELDPSDPEGAHMTTLHNSRSVATVRQIAFSRDASVLVYVCDDATVWRWNRRQTTSI 511C305E5DE86727 pcl_drome Polycomb protein Pcl Polycomblike protein Pcl CG5109 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MMNNHFHLQHDHPPQNVAHPFMQQPSTAVPSAPPATYGYLAQPAGQQPQWMTTTYQILPPSVGPATVAKRYYATTGPQTTHPTHPSTIQITNSFAQQSTPPKQQAATSCSPFKANNIRIISTAPSVYSLNKPPQEAHSTYAPVQSYYLPSGGGQTAGQINLLAASGTGKQLQPPPLVPVTNSTSPPSTVVLDRINICINNHYTETPTSLSSSLTTAQQPSPIIPAIQHKAILPLIDSSTADSSSCSSSSVSSSSYSGTATTSAAVVIVDEPDSTTTTPQTPPTTPEAMSSPGKSSPSPPLLATQSLLKGVNSMKPSFKTVEAAPPTPPTPPSPPPPPPAPPVAAPSPAVTYALQEDVFIKCNDGRFYLGTIIDQTSDQYLIRFDDQSEQWCEPDKLRKLGGGSSITAGGGGASTTESTNTSPSGPMCVACKRSDIEDVVEICERCGRGYHRGCTVEIVTGSGIWSCKRCAKPMKMQQPVSHKITKPAGICRQLPYHADKLSWDEKHRVNEEQIYCYCGKPGKFDHNMLQCCKCRNWFHTQCMQNFKKKLLRGDMFFVFCCTVCNNGIEFVRRMQIEWVDVLHIALYNLRKHQHQKYHHLLNDIWPFILEQRHQLPICEKWRTLPETALMERLKQTLKDYSDRFVCGREFKRAPAFYALRHSGPPHIPKVFLEPHEELSDELLEKRFKLMLMPEEPDEGANELPKRVPKDVYEFNTDEDDPVETSEDEIPIKQIIEKAKKQAAQKADKHDELPLKPDLADDNANDGDPGKLPAPIPPLLDANSSRKRKAFRLSKRYDNSRNHCDLSSDENSSSSRGTSSLDLIIPPPVNFLGRNNPFLMATPKKASQGRSISVGTGVGVNGIINSIFKLKGTSKEQPRMVRTIKRRLSAKDITIGPNQEVRRRRTRRLTTAIEVISTTTINPIPSHYLPIYAKDLQPPAPPMGKPTHGRLLRQRPQKQSPSQSRRNSTSSTATSSSSNGIGAPGHSMLDLKQSVNKYFGGAMNRIDAGEPFAIRAKRRMGNGQVQYLVEWGGDTATTAIGLLGN BD3325D7835EEAC3 pcl-esc 2 12 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association pcl-esc-1 2 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association pcl-esc-2 2 9 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association pcl-esc-3 1 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait association association pcl-esc-4 5 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association complex rpd3-pcl 6 8 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association rpd3-esc 6 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association rpd3-e_z_ 6 8 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association rpd3-pcl-1 6 12 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined phd finger binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association rpd3-pcl-2 6 12 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association e_z_-pcl 6 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined phd finger binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association pcl-esc-5 4 10 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component physical association physical association Ethidium bromide treated fractions from the column were further subject to co-IP using anti Esc, anti SU(Z)12 and anti PCL antibodies to emphasise the complex of the above proteins. The compelx is ~ 670 kDa in size rpd3-pcl-3 3 8 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization