IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Involvement of the Polycomb-group gene Ring1B in the specification of the anterior-posterior axis in mice. Involvement of the Polycomb-group gene Ring1B in the specification of the anterior-posterior axis in mice. Development (0950-1991) 2002 Suzuki M., Mizutani-Koseki Y., Fujimura Y., Miyagishima H., Kaneko T., Takada Y., Akasaka T., Tanzawa H., Takihara Y., Nakano M., Masumoto H., Vidal M., Isono K., Koseki H. Chromatin - Epigenetic interactions resulting in chromatin modulation koseki@med.m.chiba-u.ac.jp Mouse 11.0 dpc embryo cDNA library. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Suzuki M., Mizutani-Koseki Y., Fujimura Y., Miyagishima H., Kaneko T., Takada Y., Akasaka T., Tanzawa H., Takihara Y., Nakano M., Masumoto H., Vidal M., Isono K., Koseki H. Chromatin - Epigenetic interactions resulting in chromatin modulation 1B koseki@med.m.chiba-u.ac.jp Accepted 2006-APR-18 by JYOTI. Mouse 11.0 dpc embryo cDNA library. Development (0950-1991) 2002 Involvement of the Polycomb-group gene Ring1B in the specification of the anterior-posterior axis in mice. Involvement of the Polycomb-group gene Ring1B in the specification of the anterior-posterior axis in mice. Development (0950-1991) 2002 Suzuki M., Mizutani-Koseki Y., Fujimura Y., Miyagishima H., Kaneko T., Takada Y., Akasaka T., Tanzawa H., Takihara Y., Nakano M., Masumoto H., Vidal M., Isono K., Koseki H. Chromatin - Epigenetic interactions resulting in chromatin modulation koseki@med.m.chiba-u.ac.jp Mouse 11.0 dpc embryo cDNA library. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Suzuki M., Mizutani-Koseki Y., Fujimura Y., Miyagishima H., Kaneko T., Takada Y., Akasaka T., Tanzawa H., Takihara Y., Nakano M., Masumoto H., Vidal M., Isono K., Koseki H. Chromatin - Epigenetic interactions resulting in chromatin modulation 2b koseki@med.m.chiba-u.ac.jp Accepted 2006-APR-18 by JYOTI. Mouse 11.0 dpc embryo cDNA library. Development (0950-1991) 2002 Involvement of the Polycomb-group gene Ring1B in the specification of the anterior-posterior axis in mice. Involvement of the Polycomb-group gene Ring1B in the specification of the anterior-posterior axis in mice. Development (0950-1991) 2002 Suzuki M., Mizutani-Koseki Y., Fujimura Y., Miyagishima H., Kaneko T., Takada Y., Akasaka T., Tanzawa H., Takihara Y., Nakano M., Masumoto H., Vidal M., Isono K., Koseki H. Chromatin - Epigenetic interactions resulting in chromatin modulation koseki@med.m.chiba-u.ac.jp Mouse 11.0 dpc embryo cDNA library. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Suzuki M., Mizutani-Koseki Y., Fujimura Y., Miyagishima H., Kaneko T., Takada Y., Akasaka T., Tanzawa H., Takihara Y., Nakano M., Masumoto H., Vidal M., Isono K., Koseki H. Chromatin - Epigenetic interactions resulting in chromatin modulation koseki@med.m.chiba-u.ac.jp Accepted 2006-APR-18 by JYOTI. Mouse 11.0 dpc embryo cDNA library. Development (0950-1991) 2002 Involvement of the Polycomb-group gene Ring1B in the specification of the anterior-posterior axis in mice. Involvement of the Polycomb-group gene Ring1B in the specification of the anterior-posterior axis in mice. Development (0950-1991) 2002 Suzuki M., Mizutani-Koseki Y., Fujimura Y., Miyagishima H., Kaneko T., Takada Y., Akasaka T., Tanzawa H., Takihara Y., Nakano M., Masumoto H., Vidal M., Isono K., Koseki H. Chromatin - Epigenetic interactions resulting in chromatin modulation koseki@med.m.chiba-u.ac.jp Mouse 11.0 dpc embryo cDNA library. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Suzuki M., Mizutani-Koseki Y., Fujimura Y., Miyagishima H., Kaneko T., Takada Y., Akasaka T., Tanzawa H., Takihara Y., Nakano M., Masumoto H., Vidal M., Isono K., Koseki H. Chromatin - Epigenetic interactions resulting in chromatin modulation beta-galactosidase assay. Performed two hybrid mating assays and selected using beta-galactosidase activity using a filter assay. 1A koseki@med.m.chiba-u.ac.jp Accepted 2006-APR-18 by JYOTI. Mouse 11.0 dpc embryo cDNA library. Development (0950-1991) 2002 Involvement of the Polycomb-group gene Ring1B in the specification of the anterior-posterior axis in mice. Involvement of the Polycomb-group gene Ring1B in the specification of the anterior-posterior axis in mice. Development (0950-1991) 2002 Suzuki M., Mizutani-Koseki Y., Fujimura Y., Miyagishima H., Kaneko T., Takada Y., Akasaka T., Tanzawa H., Takihara Y., Nakano M., Masumoto H., Vidal M., Isono K., Koseki H. Chromatin - Epigenetic interactions resulting in chromatin modulation koseki@med.m.chiba-u.ac.jp Mouse 11.0 dpc embryo cDNA library. mouse-embryo Mus musculus embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Suzuki M., Mizutani-Koseki Y., Fujimura Y., Miyagishima H., Kaneko T., Takada Y., Akasaka T., Tanzawa H., Takihara Y., Nakano M., Masumoto H., Vidal M., Isono K., Koseki H. Chromatin - Epigenetic interactions resulting in chromatin modulation 11.5 dpc mouse embryos. 2a koseki@med.m.chiba-u.ac.jp Accepted 2006-APR-18 by JYOTI. Mouse 11.0 dpc embryo cDNA library. Development (0950-1991) 2002 bmi1_mouse Polycomb complex protein BMI-1 Bmi1 Pcgf4 Bmi-1 Polycomb group RING finger protein 4 protein protein mouse Mus musculus Mouse MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEEKRIITDDEIISLSIEFFDQSRLDRKVNKEKPKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKMSHQRDGLTNAGELESDSGSDKANSPAGGVPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSANHQSSFASRPRKSSLNGSSATSSG DIP protein P25916 original sequence version: 81 DIP protein P25916 original sequence version: 133 AD7DECDB6B29DCE5 pcgf2_mouse Polycomb group RING finger protein 2 Pcgf2 Mel18 Mel-18 Rnf110 Zfp144 Znf144 DNA-binding protein Mel-18 Melanoma nuclear protein 18 RING finger protein 110 Zinc finger protein 144 protein protein mouse Mus musculus Mouse MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQVHKTRPLLSIRSDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQEKGALGDDEIVSLSIEFYEGVRDREEKKNLTENGDGDKEKTGVRFLRCPAAMTVMHLAKFLRNKMDVPSKYKVEILYEDEPLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLPTVPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHGPPATHPTSPTPPSTAAGTTTATNGGTSNCLQTPSSTSRGRKMTVNGAPCPP DIP protein P23798 original sequence version: 79 C23031B8B9E30108 phc2_mouse Polyhomeotic-like protein 2 p36 Early development regulatory protein 2 Phc2 Edr2 Ph2 protein protein mouse Mus musculus Mouse MENELPVPHTSNRASVTTNTSGTNSSSGCISSSGGGGGSGGRPTAPQISVYSGIPDRQTVQVIQQALHRQPSTAAQYLQQMYAAQQQHLMLQTAALQQQHLSSAQLQSLAAVQQASLVANRQGSTPGSSVSSQAPAQSSSLNLAASPAAAQLINRAQSVNSAAASGLAQQAVLLGNTSSPALTASQAQMYLRAQMLIFTPTATVATVQPELCTGSPARPPTPAQVQNLTLRTQQTPAAAASGPPPTQPVLPSLALKPTPSSSQPLPAPPQGRTMAQGSPAGAKPSGTDNAPETLKAGDGNCNMEGRPGPGRAVPAVATHPLIAPAYAHLQSHQLLPQPPAKHPQPQFVAQQQPQPPRPAPQVQSQPQLASVSPSLALQSSPEDHALPLGSVTQALPLQCSTTHVHKPGNSQQCHLPTLDTGSQNGHPEGGSHPPQRRFQHTSAVILQVQPASPVTPQQCAPDDWKEVVPAEKSVPVARPGPSPHQQAIIPAIPGGLPGPKSPNIQQCPAHETGQGIVHALTDLSSPGMTSGNGNSASSIAGTAPQNGENKPPQAIVKPQILTHVIEGFVIQEGAEPFPVGRSSLLVGNLKKKYAQGFLPEKPPQQDHTTTTDSEMEEPYLQESKEEGTPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGTTTHNRRRASKASLPTLTKDTKKQPSGTVPLSVTAALQLAHSQEDSSRCSDNSSYEEPLSPISASSSTSRRRQGQRDLDLPDMHMRDLVGVGHHFLPSEPTKWNVEDVYEFIRSLPGCQEIAEEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKIYARISMLKDS 87746AFD7808DC7B phc1_mouse Polyhomeotic-like protein 1 Phc1 Edr Edr1 Rae28 Early development regulatory protein 1 RAE-28 protein protein mouse Mus musculus Mouse METESEQNSSSTNGSSSSGASSRPQIAQMSLYERQAVQALQALQRQPNAAQYFHQFMLQQQLSNAQLHSLAAVQQATIAASRQASSPNSSTAQQQTATTQASMNLATTSAAQLISRSQSVSSPSATTLTQSVLLGNTTSPPLNQSQAQMYLRPQLGNLLQVNRTLGRNVPLASQLILMPNGAVAAVQQEVPPAQSPGVHADADQVQNLAVRNQQASAQGPQMPGSTQKAIPPGASPVSGLSQTSSQALAVAQASSGASGQSLNLSQAGGGSGNSLPGSMGPGGGGQAPGGLGQLPSSGLTGGSCPRKGTGVVQPLPAAQTVTVSQGSQTEAESAAAKKAEADGSGQQSVGMNLTRTATPAPSQTLISSATYTQIQPHSLIQQQQQIHLQQKQVVIQQQIAIHHQQQFQHRQSQLLHTATHLQLAQQQQQQQQQQQQQQQQQQQQQQQQGTTLTAPQPPQVPPTQQVPPSQSQQQAQTLVVQPMLQSSPLTLPPEPTSKPPIPIQSKPPVAPIKPPQLGAAKMSATQQPPPHIPVQVVGTRQPGSAQAQALGLAQLAAAVPTPRGITGAVQPGQAHLASSPPSSQAAPGALQECPPALAAGMTLAPVQGTAHVVKGGPTASSPVVAQVPAAFYMQSVHLPGKAQTLAVKRKAESEEERDDLSALASVLPTKASPAAESPKVIEEKNSLGEKAEPVASLNANPPNSDLVALAPTPSAPPPTLALVSRQMGDSKPPQAIVKPQILTHIIEGFVIQEGAEPFPVGCSQFLKETEKPLQAGLPTGLNESQPSGPLGGDSPSVELEKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEASYARVRRRGPRRSSSDIARAKIQGKRHRGQEDSSRGSDNSSYDEALSPTSPGPLSVRAGHGERDLGNTITTPSTPELQGINPVFLSSNPSQWSVEEVYEFIASLQGCQEIAEEFRSQEIDGQALLLLKEEHLMSAMNIKLGPALKICAKINVLKET DIP protein Q64028 original sequence version: 119 5DA12A87D0B5FDDB ring2_mouse E3 ubiquitin-protein ligase RING2 Rnf2 DinG Ring1b RING finger protein 2 RING finger protein 1B RING-type E3 ubiquitin transferase RING2 protein protein mouse Mus musculus Mouse MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAVAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK DIP protein Q9CQJ4 original sequence version: 124 DIP protein Q9CQJ4 original sequence version: 115 84BA5B3E044DB7EC pcgf2-rnf2 3 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association pcgf2-phc2 3 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association pcgf2-phc1 3 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association pcgf2-rnf2-1 4 7 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score Interacted strongly. pcgf2-rnf2-2 4 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score Interacted strongly. pcgf4-rnf2 4 10 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score Interacted strongly. pcgf4-rnf2-1 4 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score Interacted strongly. pcgf2-rnf2-3 1 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-927606]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 365-365, sequence length 336 [EBI-927606]189-365 ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association The length of Q9CQJ4 in 12183370 is 365 amino acids, but in UniProt Q9CQJ4 is only 336 residues. The N-terminus of Q9CQJ4 binds better than the C-terminus. rnf2-pcgf2 1 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-927615]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 365-365, sequence length 336 [EBI-927615]189-365 region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association The length of Q9CQJ4 in 12183370 is 365 amino acids, but in UniProt Q9CQJ4 is only 336 residues. The N terminus of Q9CQJ4 binds better than the C terminus. pcgf2-rnf2-4 5 7 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association phc1-rnf2 5 10 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait physical association physical association pcgf2-rnf2-5 2 10 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization