IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Polycomblike PHD fingers mediate conserved interaction with enhancer of zeste protein. Polycomblike PHD fingers mediate conserved interaction with enhancer of zeste protein. J. Biol. Chem. (0021-9258) 2001 O'Connell S., Wang L., Robert S., Jones CA., Saint R., Jones RS. Chromatin - Epigenetic interactions resulting in chromatin modulation drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot O'Connell S., Wang L., Robert S., Jones CA., Saint R., Jones RS. Chromatin - Epigenetic interactions resulting in chromatin modulation HA-esc embryos used for the experiment. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2001 Polycomblike PHD fingers mediate conserved interaction with enhancer of zeste protein. Polycomblike PHD fingers mediate conserved interaction with enhancer of zeste protein. J. Biol. Chem. (0021-9258) 2001 O'Connell S., Wang L., Robert S., Jones CA., Saint R., Jones RS. Chromatin - Epigenetic interactions resulting in chromatin modulation in vitro In vitro pull down pull down predetermined predetermined participant predetermined O'Connell S., Wang L., Robert S., Jones CA., Saint R., Jones RS. Chromatin - Epigenetic interactions resulting in chromatin modulation Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2001 Polycomblike PHD fingers mediate conserved interaction with enhancer of zeste protein. Polycomblike PHD fingers mediate conserved interaction with enhancer of zeste protein. J. Biol. Chem. (0021-9258) 2001 O'Connell S., Wang L., Robert S., Jones CA., Saint R., Jones RS. Chromatin - Epigenetic interactions resulting in chromatin modulation drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot O'Connell S., Wang L., Robert S., Jones CA., Saint R., Jones RS. Chromatin - Epigenetic interactions resulting in chromatin modulation HA-esc embryos used for the experiment. Nuclear extract used. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2001 Polycomblike PHD fingers mediate conserved interaction with enhancer of zeste protein. Polycomblike PHD fingers mediate conserved interaction with enhancer of zeste protein. J. Biol. Chem. (0021-9258) 2001 O'Connell S., Wang L., Robert S., Jones CA., Saint R., Jones RS. Chromatin - Epigenetic interactions resulting in chromatin modulation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined O'Connell S., Wang L., Robert S., Jones CA., Saint R., Jones RS. Chromatin - Epigenetic interactions resulting in chromatin modulation Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2001 Polycomblike PHD fingers mediate conserved interaction with enhancer of zeste protein. Polycomblike PHD fingers mediate conserved interaction with enhancer of zeste protein. J. Biol. Chem. (0021-9258) 2001 O'Connell S., Wang L., Robert S., Jones CA., Saint R., Jones RS. Chromatin - Epigenetic interactions resulting in chromatin modulation drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot O'Connell S., Wang L., Robert S., Jones CA., Saint R., Jones RS. Chromatin - Epigenetic interactions resulting in chromatin modulation HA-esc embryos used for the experiment. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2001 Polycomblike PHD fingers mediate conserved interaction with enhancer of zeste protein. Polycomblike PHD fingers mediate conserved interaction with enhancer of zeste protein. J. Biol. Chem. (0021-9258) 2001 O'Connell S., Wang L., Robert S., Jones CA., Saint R., Jones RS. Chromatin - Epigenetic interactions resulting in chromatin modulation in vitro In vitro pull down pull down predetermined predetermined participant predetermined O'Connell S., Wang L., Robert S., Jones CA., Saint R., Jones RS. Chromatin - Epigenetic interactions resulting in chromatin modulation Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2001 esc_drome Polycomb protein esc esc CG14941 Protein extra sex combs protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSSDKVKNGNEPEESEESCGDESASYTTNSTTSRSKSPSSSTRSKRRGRRSTKSKPKSRAAYKYDTHVKENHGANIFGVAFNTLLGKDEPQVFATAGSNRVTVYECPRQGGMQLLHCYADPDPDEVFYTCAWSYDLKTSSPLLAAAGYRGVIRVIDVEQNEAVGNYIGHGQAINELKFHPHKLQLLLSGSKDHAIRLWNIQSHVCIAILGGVEGHRDEVLSIDFNMRGDRIVSSGMDHSLKLWCLNTPEFHHKIELSNTFSQEKSTLPFPTVTKHFPDFSTRDIHRNYVDCVQWFGNFVLSKSCENAIVCWKPGQLHQSFEQVKPSDSSCTIIAEFEYDECEIWFVRFGFNPWQKVIALGNQQGKVYVWELDPSDPEGAHMTTLHNSRSVATVRQIAFSRDASVLVYVCDDATVWRWNRRQTTSI 511C305E5DE86727 phf1_human PHD finger protein 1 PCL1 Polycomb-like protein 1 PHF1 protein protein human Homo sapiens Human MAQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVPGNRLVSCEKCRHAYHQDCHVPRAPAPGEGEGTSWVCRQCVFAIATKRGGALKKGPYARAMLGMKLSLPYGLKGLDWDAGHLSNRQQSYCYCGGPGEWNLKMLQCRSCLQWFHEACTQCLSKPLLYGDRFYEFECCVCRGGPEKVRRLQLRWVDVAHLVLYHLSVCCKKKYFDFDREILPFTSENWDSLLLGELSDTPKGERSSRLLSALNSHKDRFISGREIKKRKCLFGLHARMPPPVEPPTGDGALTSFPSGQGPGGGVSRPLGKRRRPEPEPLRRRQKGKVEELGPPSAVRNQPEPQEQRERAHLQRALQASVSPPSPSPNQSYQGSSGYNFRPTDARCLPSSPIRMFASFHPSASTAGTSGDSGPPDRSPLELHIGFPTDIPKSAPHSMTASSSSVSSPSPGLPRRSAPPSPLCRSLSPGTGGGVRGGVGYLSRGDPVRVLARRVRPDGSVQYLVEWGGGGIF DIP protein O43189 original sequence version: 124 E81BA9475565957C pcl_drome Polycomb protein Pcl Polycomblike protein Pcl CG5109 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MMNNHFHLQHDHPPQNVAHPFMQQPSTAVPSAPPATYGYLAQPAGQQPQWMTTTYQILPPSVGPATVAKRYYATTGPQTTHPTHPSTIQITNSFAQQSTPPKQQAATSCSPFKANNIRIISTAPSVYSLNKPPQEAHSTYAPVQSYYLPSGGGQTAGQINLLAASGTGKQLQPPPLVPVTNSTSPPSTVVLDRINICINNHYTETPTSLSSSLTTAQQPSPIIPAIQHKAILPLIDSSTADSSSCSSSSVSSSSYSGTATTSAAVVIVDEPDSTTTTPQTPPTTPEAMSSPGKSSPSPPLLATQSLLKGVNSMKPSFKTVEAAPPTPPTPPSPPPPPPAPPVAAPSPAVTYALQEDVFIKCNDGRFYLGTIIDQTSDQYLIRFDDQSEQWCEPDKLRKLGGGSSITAGGGGASTTESTNTSPSGPMCVACKRSDIEDVVEICERCGRGYHRGCTVEIVTGSGIWSCKRCAKPMKMQQPVSHKITKPAGICRQLPYHADKLSWDEKHRVNEEQIYCYCGKPGKFDHNMLQCCKCRNWFHTQCMQNFKKKLLRGDMFFVFCCTVCNNGIEFVRRMQIEWVDVLHIALYNLRKHQHQKYHHLLNDIWPFILEQRHQLPICEKWRTLPETALMERLKQTLKDYSDRFVCGREFKRAPAFYALRHSGPPHIPKVFLEPHEELSDELLEKRFKLMLMPEEPDEGANELPKRVPKDVYEFNTDEDDPVETSEDEIPIKQIIEKAKKQAAQKADKHDELPLKPDLADDNANDGDPGKLPAPIPPLLDANSSRKRKAFRLSKRYDNSRNHCDLSSDENSSSSRGTSSLDLIIPPPVNFLGRNNPFLMATPKKASQGRSISVGTGVGVNGIINSIFKLKGTSKEQPRMVRTIKRRLSAKDITIGPNQEVRRRRTRRLTTAIEVISTTTINPIPSHYLPIYAKDLQPPAPPMGKPTHGRLLRQRPQKQSPSQSRRNSTSSTATSSSSNGIGAPGHSMLDLKQSVNKYFGGAMNRIDAGEPFAIRAKRRMGNGQVQYLVEWGGDTATTAIGLLGN BD3325D7835EEAC3 ezh2_human Histone-lysine N-methyltransferase EZH2 KMT6 Enhancer of zeste homolog 2 ENX-1 Lysine N-methyltransferase 6 EZH2 protein protein human Homo sapiens Human MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP DIP protein Q15910 original sequence version: 97 DIP protein Q15910 original sequence version: 94 DIP protein Q15910 original sequence version: 92 DIP protein Q15910 original sequence version: 96 DIP protein Q15910 original sequence version: 122 DIP protein Q15910 original sequence version: 100 1B5029EB9D509BE5 ez_drome Histone-lysine N-methyltransferase E(z) KMT6 E(z) CG6502 Protein enhancer of zeste Lysine N-methyltransferase 6 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNSTKVPPEWKRRVKSEYIKIRQQKRYKRADEIKEAWIRNWDEHNHNVQDLYCESKVWQAKPYDPPHVDCVKRAEVTSYNGIPSGPQKVPICVINAVTPIPTMYTWAPTQQNFMVEDETVLHNIPYMGDEVLDKDGKFIEELIKNYDGKVHGDKDPSFMDDAIFVELVHALMRSYSKELEEAAPGTATAIKTETLAKSKQGEDDGVVDVDADGESPMKLEKTDSKGDLTEVEKKETEEPLETEDADVKPDVEEVKDKLPFPAPIIFQAISANFPDKGTAQELKEKYIELTEHQDPERPQECTPNIDGIKAESVSRERTMHSFHTLFCRRCFKYDCFLHRLQGHAGPNLQKRRYPELKPFAEPCSNSCYMLIDGMKEKLAADSKTPPIDSCNEASSEDSNDSNSQFSNKDFNHENSKDNGLTVNSAAVAEINSIMAGMMNITSTQCVWTGADQALYRVLHKVYLKNYCAIAHNMLTKTCRQVYEFAQKEDAEFSFEDLRQDFTPPRKKKKKQRLWSLHCRKIQLKKDSSSNHVYNYTPCDHPGHPCDMNCSCIQTQNFCEKFCNCSSDCQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCQACGADQFKLTKITCKNVCVQRGLHKHLLMAPSDIAGWGIFLKEGAQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSINPNCYAKVMMVTGDHRIGIFAKRAIQPGEELFFDYRYGPTEQLKFVGIEREMEIV 022360ED7772EB60 pcl-e_z_ 4 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait phd finger binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q24459:p.Cys430Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C A Wed May 02 15:35:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys430ala' Tue Jun 30 15:46:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys430Ala' Q24459:p.Cys430Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:54:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys430ser' Tue Jun 30 19:25:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys430Ser' Q24459:p.Cys517Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C A Wed May 02 16:08:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys517ala' Tue Jun 30 18:22:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys517Ala' Q24459:p.Cys517Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C S Wed May 02 18:37:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys517ser' Tue Jun 30 17:05:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys517Ser' cys 442ala PHD finger 1 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys530ala PHD finger 2 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association pcl-e_z_-1 2 9 unspecified role unspecified role bait bait phd finger binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association pcl-e_z_-2 6 9 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:27:42 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'glu asp glu' ecoli Escherichia coli (strain K12) physical association physical association pcl-e_z_-3 6 11 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association phf1-ezh2 4 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association esc-pcl 1 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association esc-pcl-1 1 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association esc-pcl-2 5 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey association association esc-pcl-3 3 11 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component physical association physical association