IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Tantalus, a novel ASX-interacting protein with tissue-specific functions. Tantalus, a novel ASX-interacting protein with tissue-specific functions. Dev. Biol. (0012-1606) 2001 imex curation Dietrich BH., Moore J., Kyba M., dosSantos G., McCloskey F., Milne TA., Brock HW., Krause HM. Chromatin - Epigenetic interactions resulting in chromatin modulation h.krause@utoronto.ca 02-MAR-2006: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Dietrich BH., Moore J., Kyba M., dosSantos G., McCloskey F., Milne TA., Brock HW., Krause HM. Chromatin - Epigenetic interactions resulting in chromatin modulation h.krause@utoronto.ca Accepted 2007-FEB-21 by DAVET. 02-MAR-2006: Contacted by JYOTI. Dev. Biol. (0012-1606) 2001 Only protein-protein interactions imex curation Tantalus, a novel ASX-interacting protein with tissue-specific functions. Tantalus, a novel ASX-interacting protein with tissue-specific functions. Dev. Biol. (0012-1606) 2001 imex curation Dietrich BH., Moore J., Kyba M., dosSantos G., McCloskey F., Milne TA., Brock HW., Krause HM. Chromatin - Epigenetic interactions resulting in chromatin modulation h.krause@utoronto.ca 02-MAR-2006: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Dietrich BH., Moore J., Kyba M., dosSantos G., McCloskey F., Milne TA., Brock HW., Krause HM. Chromatin - Epigenetic interactions resulting in chromatin modulation h.krause@utoronto.ca Accepted 2007-FEB-21 by DAVET. 02-MAR-2006: Contacted by JYOTI. 0- to 12-h drosophila embryonic cDNA library Dev. Biol. (0012-1606) 2001 Only protein-protein interactions imex curation Tantalus, a novel ASX-interacting protein with tissue-specific functions. Tantalus, a novel ASX-interacting protein with tissue-specific functions. Dev. Biol. (0012-1606) 2001 imex curation Dietrich BH., Moore J., Kyba M., dosSantos G., McCloskey F., Milne TA., Brock HW., Krause HM. Chromatin - Epigenetic interactions resulting in chromatin modulation h.krause@utoronto.ca 02-MAR-2006: Contacted by JYOTI. Only protein-protein interactions drome-salivary_gland Drosophila melanogaster Salivary gland salivary_gland Salivary gland fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Dietrich BH., Moore J., Kyba M., dosSantos G., McCloskey F., Milne TA., Brock HW., Krause HM. Chromatin - Epigenetic interactions resulting in chromatin modulation Salivary gland polytene chromosome from a third instar larva was used. h.krause@utoronto.ca Accepted 2007-FEB-21 by DAVET. 02-MAR-2006: Contacted by JYOTI. Dev. Biol. (0012-1606) 2001 Only protein-protein interactions imex curation asx_drome Polycomb protein Asx Asx CG8787 Additional sex combs protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKTITPDTTTTTSSQHQQLLIPQADQHHQPMLQQQSLLAAPPPTMIMEHVNLVDDDEKDPLALEQLEVSPSTKHTHSLRRHLPRIIVKPIPPEKKPMAPSEEAAVSTAPAPPTRLICSRRIQQQQQVKAAAAAAAAAAAAAAAAAAAAQAQATSSYPSAISPGSKAGTSQASTMREVLASIPGFSVKPRRRSNKKLTTAAQIEQTKDGKIDLETPDSILASTNLRALLNKQTFSLLPPLYQYNLIQLLPSVDREASELEQPSSSASGGSPSEAIRLSASCLNNEFFARACLEWRERLSEGEFTPENQLKLKTEAEREKNKLDPWKLKHFEPFWGEKNSRGKDKDKLESDCKNQKLSASIKSEPKPPATSQQKPLQQATCDNETELKFDLSTKCETTSAKTTVAVAVADKSSTFPPTGSQNNVLNEQQRRVLKRPSSSPSQRKQAPTTIATINLDDDLDELPSTSKDSKQPKMDEIVPNASGNVVAAPMVDVVDHSAVEMKIKDEQQHQRQHQPLINSTCDKIEPSECSKEMIVAMKQVDSKEDVDSIASAAAMPAIAAVTPHTPKPEALAPNPDVANQFVSYLQNVELAAETKAPLDNSNEADITTGTNSHDFVFSDTIDHAYFQEHQSTINHNFFTSSSSSNTATTAANKLEEHSDKPEDSPLPIASSISGSTPASSITSTSCTSSSSSSASMSSSCSSSNSGSTTTAPTTSSSAGAPTAPLTLAAAAETTLANVQAMLSTVAKLQQQQQELPVELNSNEMYQHVQHDWNFGDIKLSSSQSSGDQQRNLSHEAIDLMDVVQDADVIDDIMHNDVCHDVLGDEDEGDQEEDEDDEVVECMTEEQQLIDEDSEAVREIVDKLQQHQQQQNQQQHHQQLHIQDVVQLAQHSFMPQAHSEFGNDIGQEMLCDAVPMSAAEMEVSSTVITNSSNSNDSSNNISLCSSTNSLTINQMPHQASQQPQQNAQSNAQQQRQILVDSNGQIIGNFLLQQQRQQQQQQLLQQFTLQAAAAQQQQQQQQQHQQQQQQQQQATSSNSLGKTLPVALRNGTQQFLSPNLIAQQHQQQQQQQLEQHQQQATAQQKHQQIQQFALQQAQLHQRQLLAQAANNNLLQQQQQQQQNVALPTTQAKFIAKPLNIISMTRPANASPTTAATTANTASIPSAYANVVAVTGAQQQQSPPVPAPQQQTVQQQQLANHNSNMQQLPNVLTMKTLPPSGVPTTIAQQRLQPKMPTGKGRKATSNRLPPGAVNLERSYQICQAVIQNSPNRENLKAQLRPPAAILNQHQPTTTTAPAPINPVTLNVSTVAATPMSNITTATGSMAAAVAAAPPQNVLKQEELLVSGAVGAGALPAGLPPNVMGVGRPGVYKVIGPRMSGFPRKKYVQRKPSPTTLIRHVFSPGPGGATATAQQLQMLQQHHQSTTSPVPVQNPQQPAPEQLIHQNGNGQYVLVHRANVGAADNQAPRASSAPPMHQNQFVTVQNPLHSINGIPMGGRGRPASVDTTAGSGNVIAPPISATDALHHHHHEMQQQQQHQQPQPLGNVGAAANIVRRNIAAGPNIAYIDGSNTNSSAVALMEAGNNYIVTTNASPTAAPSPINQQPQSQPTGTQHQHPLLQLHQTGENTPPGNEATATANNCACSLNAMVICQQCGAFCHDDCIGAAKLCVACVIR DIP protein Q9V727 original sequence version: 73 F65D87398D67D321 tant_drome Protein tantalus tant tan CG6586 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDNIVYDFAKITFQAKDNRSPTTNSNLSWQLNQMALSDMEEMQDTSEPIAPPESDDNVSSESHDSDDVDSQLSRCEDNDDDSDCISGSSRRSSTFGARAGVARRRMPARVSKDNFNRICSAIMKPIKKKQRKELNTNAQTLKSIEKIYTSRRMKKFTPTNLETIFEEPSDENAADAEDDSEECSISSQVKVVKVWGRKLRRAISFSDGLNKNKILSKRRRQKVKKTFGKRFALKKISMTEFHDRLNKSFDSAMLEGDDAEAGGSAEAVNIPKTSMTMEDIQLPTMSSQHQFLMQPAGFE D087870EC0B16233 asx-tan 1 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 4 unspecified role unspecified role bait bait c terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 1 To verify the two-hybrid interaction between ASX and TAN, a GST pull-down assay was employed. asx-tan-1 2 4 unspecified role unspecified role bait bait c terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey in vitro In vitro physical association physical association A 0- to 12-h embryonic cDNA library was screened, and out of approximately 105 clones, 11 unique interacting constructs were recovered (data not shown). One of these, which we have subsequently named tantalus (tan), is described here. asx-tan-2 3 5 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization Colocalization of endogenous ASX (D; red) and TAN (E; green) on a section of salivary gland polytene chromosome from a third instar larva. 5D-F