MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structure of a DNA-bound Ultrabithorax-Extradenticle homeodomain complex. Structure of a DNA-bound Ultrabithorax-Extradenticle homeodomain complex. Nature (0028-0836) 1999 Passner JM., Ryoo HD., Shen L., Mann RS., Aggarwal AK. Chromatin - Epigenetic interactions resulting in chromatin modulation no in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Passner JM., Ryoo HD., Shen L., Mann RS., Aggarwal AK. Chromatin - Epigenetic interactions resulting in chromatin modulation no Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nature (0028-0836) 1999 ubx_drome Homeotic protein ultrabithorax Ubx CG10388 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNSYFEQASGFYGHPHQATGMAMGSGGHHDQTASAAAAAYRGFPLSLGMSPYANHHLQRTTQDSPYDASITAACNKIYGDGAGAYKQDCLNIKADAVNGYKDIWNTGGSNGGGGGGGGGGGGGAGGTGGAGNANGGNAANANGQNNPAGGMPVRPSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAAAAAAAVQGGHLDQ DIP protein P83949 original sequence version: 121 DIP protein P83949 original sequence version: 97 D452E8FFE55D8F53 exd_drome Homeobox protein extradenticle exd CG8933 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEDPNRMLAHTGGMMAPQGYGLSGQDDGQNAGSENEVRKQKDIGEILQQIMSISEQSLDEAQARKHTLNCHRMKPALFSVLCEIKEKTVLSIRNTQEEEPPDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPKEIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGASPYSMAGPPSGTTTPMMSPAPPQDSMGYPMGSGGYDQQQPYDNSMGGYDPNLHQDLSP DIP protein P40427 original sequence version: 142 DIP protein P40427 original sequence version: 120 79E3DC8F1F6B711F ubx-exd-1 1 2 unspecified role unspecified role neutral component neutral component P83949:p.Cys333Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:26:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys333ser' Tue Jun 30 18:08:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys333Ser' homeobox binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component homeobox binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Revisit when DNA Editor in place. Crystallisation in the presence of DNA P83949-5 AA 233-313 (IPR001356) of Isoform IVA of UBX 2.40 working 22.4%, free 30.4%