bhf-ucl Purified hybrid insulin/insulin-like growth factor-I receptors bind insulin-like growth factor-I, but not insulin, with high affinity. Purified hybrid insulin/insulin-like growth factor-I receptors bind insulin-like growth factor-I, but not insulin, with high affinity. Biochem. J. (0264-6021) 1993 imex curation Soos M.A., Field C.E., Siddle K. Cardiac - Interactions involving cardiac related proteins Results obtained using receptor hybrids have not been entered as the exact identity of the molecules involved is not known ks14@mole.bio.cam.ac.uk 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro competition binding competition binding tag visualisation tag visualisation Soos M.A., Field C.E., Siddle K. Cardiac - Interactions involving cardiac related proteins Purified Receptors were obtained by immunodepletion followed by receptor specific immunoprecipitation. Results obtained using receptor hybrids have not been entered as the exact identity of the molecules involved is not known ks14@mole.bio.cam.ac.uk Accepted 2014-FEB-13 by MGT Biochem. J. (0264-6021) 1993 Only protein-protein interactions imex curation Purified hybrid insulin/insulin-like growth factor-I receptors bind insulin-like growth factor-I, but not insulin, with high affinity. Purified hybrid insulin/insulin-like growth factor-I receptors bind insulin-like growth factor-I, but not insulin, with high affinity. Biochem. J. (0264-6021) 1993 imex curation Soos M.A., Field C.E., Siddle K. Cardiac - Interactions involving cardiac related proteins Results obtained using receptor hybrids have not been entered as the exact identity of the molecules involved is not known ks14@mole.bio.cam.ac.uk 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro affinity techniques affinity technology affinity techniques tag visualisation tag visualisation Soos M.A., Field C.E., Siddle K. Cardiac - Interactions involving cardiac related proteins Purified Receptors were obtained by immunodepletion followed by receptor specific immunoprecipitation. Results obtained using receptor hybrids have not been entered as the exact identity of the molecules involved is not known ks14@mole.bio.cam.ac.uk Accepted 2014-FEB-13 by MGT Biochem. J. (0264-6021) 1993 Only protein-protein interactions imex curation ins_bovin Insulin INS protein protein bovin Bos taurus (Bovine) Bovine MALWTRLRPLLALLALWPPPPARAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEGPQVGALELAGGPGAGGLEGPPQKRGIVEQCCASVCSLYQLENYCN DIP protein P01317 original sequence version: 131 75307CF78E61C06A insr_human Insulin receptor INSR protein protein human Homo sapiens Human MATGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDVGNVTVAVPTVAAFPNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS 709A955660739066 igf1r_human Insulin-like growth factor 1 receptor Insulin-like growth factor I receptor IGF1R protein protein human Homo sapiens Human MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC DIP protein P08069 original sequence version: 170 DIP protein P08069 original sequence version: 109 DIP protein P08069 original sequence version: 139 DIP protein P08069 original sequence version: 185 AE8A735F87F745C8 igf1_human Insulin-like growth factor I IGF1 IBP1 Somatomedin-C Mechano growth factor protein protein human Homo sapiens Human MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK DIP protein P05019 original sequence version: 130 DIP protein P05019 original sequence version: 178 DIP protein P05019 original sequence version: 140 DIP protein P05019 original sequence version: 186 DIP protein P05019 original sequence version: 151 The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity Defects in IGF1 are the cause of insulin-like growth factor I deficiency (IGF1 deficiency) [MIM:608747]. IGF1 deficiency is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness and mental retardation mint E88A8CFBD1CD1873 igf1r-igf1-3 1 6 unspecified role unspecified role prey prey 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta physical association physical association Fig.2 A/C igf1r-igf1-3 1 6 unspecified role unspecified role prey prey i125 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 competitor competitor competitor unspecified role unspecified role 5 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta physical association physical association Fig.2 A, Table 4 igf1r-igf1-3 1 6 unspecified role unspecified role prey prey i125 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 competitor competitor competitor unspecified role unspecified role 5 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta physical association physical association Fig.2 C, Table 4 insr-igf1 1 6 unspecified role unspecified role prey prey 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta physical association physical association Fig.2 A/C insr-igf1-1 1 6 unspecified role unspecified role prey prey 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta 3 competitor competitor competitor unspecified role unspecified role physical association physical association Fig.2 C, Table 4 insr-igf1-2 1 6 unspecified role unspecified role prey prey 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 competitor competitor competitor unspecified role unspecified role 4 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta physical association physical association Fig.2 A, Table 4 insr-ins-2 1 4 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta 3 unspecified role unspecified role prey prey 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig.2 B/D insr-ins-2 1 4 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta 3 competitor competitor competitor unspecified role unspecified role 3 unspecified role unspecified role prey prey 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig.2 B, Table 4 insr-ins-2 1 6 competitor competitor competitor unspecified role unspecified role 3 unspecified role unspecified role prey prey 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta physical association physical association Fig.2D , Table 4 igf1r-ins 1 5 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta 3 unspecified role unspecified role prey prey 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig.2 B/D igf1r-ins-2 1 3 competitor competitor competitor unspecified role unspecified role 5 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta 3 unspecified role unspecified role prey prey 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig.2 B, Table 4 igf1r-ins-4 1 6 competitor competitor competitor unspecified role unspecified role 5 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta 3 unspecified role unspecified role prey prey 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig.2D , Table 4 ins-insr 2 3 unspecified role unspecified role unspecified role unspecified role 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role unspecified role unspecified role human-placenta Homo sapiens placenta placenta physical association physical association Table 5 DTT -Dithiothreitol igf1-igf1r-1 2 6 unspecified role unspecified role unspecified role unspecified role 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role unspecified role unspecified role human-placenta Homo sapiens placenta placenta physical association physical association Table 5 DTT -Dithiothreitol had little effect on binding.