IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Determination of the critical residues responsible for cardiac myosin binding protein C's interactions. Determination of the critical residues responsible for cardiac myosin binding protein C's interactions. Journal of molecular and cellular cardiology 2012 imex curation Bhuiyan MS., Gulick J., Osinska H., Gupta M., Robbins J. Cardiac - Interactions involving cardiac related proteins Results from the F-actin Co-sedimentation Assay have not been included as the Bovine Actin used is a mixture of two proteins;cardiac and skeletal forms. MHY6 would seem sensible for "myosin" as it is a cardiac form and the alpha form is the predominant one in the mouse; however nothing is stated in this publication regarding exact identity of this protein. (Myosin 7/7B is also Cardiac - but have not found this in any references I think - lost track) Please add IMEX ID if you accept this publication or think it will be accepted - I dont want to waste an ID. The authors have confirmed that the construct "S2-MyHC" contains the Myh6 heavy chain. The S2 Head region numbering was derivied from Ref 33 (Pmid:10024460) Figure 9, from the sequence given for Rat Cardiac alpha MHC. Mutation numbering has been referenced to UniProt sequences, which differs slightly from that used in this publication. jeff.robbins@cchmc.org Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bhuiyan MS., Gulick J., Osinska H., Gupta M., Robbins J. Cardiac - Interactions involving cardiac related proteins Results from the F-actin Co-sedimentation Assay have not been included as the Bovine Actin used is a mixture of two proteins;cardiac and skeletal forms. MHY6 would seem sensible for "myosin" as it is a cardiac form and the alpha form is the predominant one in the mouse; however nothing is stated in this publication regarding exact identity of this protein. (Myosin 7/7B is also Cardiac - but have not found this in any references I think - lost track) Please add IMEX ID if you accept this publication or think it will be accepted - I dont want to waste an ID. Stated to be Y-3-H: here expression of a third protein results in abrogation of a complex that is normally formed when the other two proteins are expressed. The third protein is expressed as part of the Bait construct under the control of a separate (Met25) promoter, which is only active in the absence of methionine in the medium. The authors have confirmed that the construct "S2-MyHC" contains the Myh6 heavy chain. The S2 Head region numbering was derivied from Ref 33 (Pmid:10024460) Figure 9, from the sequence given for Rat Cardiac alpha MHC. Mutation numbering has been referenced to UniProt sequences, which differs slightly from that used in this publication. jeff.robbins@cchmc.org Accepted 2015-JUN-02 by ORCHARD Journal of molecular and cellular cardiology 2012 Only protein-protein interactions imex curation imex curation The authors replied very quickly - I have altered Data Proc statements throughout. Determination of the critical residues responsible for cardiac myosin binding protein C's interactions. Determination of the critical residues responsible for cardiac myosin binding protein C's interactions. Journal of molecular and cellular cardiology 2012 imex curation Bhuiyan MS., Gulick J., Osinska H., Gupta M., Robbins J. Cardiac - Interactions involving cardiac related proteins Results from the F-actin Co-sedimentation Assay have not been included as the Bovine Actin used is a mixture of two proteins;cardiac and skeletal forms. MHY6 would seem sensible for "myosin" as it is a cardiac form and the alpha form is the predominant one in the mouse; however nothing is stated in this publication regarding exact identity of this protein. (Myosin 7/7B is also Cardiac - but have not found this in any references I think - lost track) Please add IMEX ID if you accept this publication or think it will be accepted - I dont want to waste an ID. The authors have confirmed that the construct "S2-MyHC" contains the Myh6 heavy chain. The S2 Head region numbering was derivied from Ref 33 (Pmid:10024460) Figure 9, from the sequence given for Rat Cardiac alpha MHC. Mutation numbering has been referenced to UniProt sequences, which differs slightly from that used in this publication. jeff.robbins@cchmc.org Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bhuiyan MS., Gulick J., Osinska H., Gupta M., Robbins J. Cardiac - Interactions involving cardiac related proteins The authors have confirmed that the construct "S2-MyHC" contains the Myh6 heavy chain. The S2 Head region numbering was derivied from Ref 33 (Pmid:10024460) Figure 9, from the sequence given for Rat Cardiac alpha MHC. Mutation numbering has been referenced to UniProt sequences, which differs slightly from that used in this publication. jeff.robbins@cchmc.org Md_Shenuarin.Bhuiyan@cchmc.org,James.Gulick@cchmc.org,Hanna.Osinska@cchmc.org,Manaish.Gupta@cchmc.org,jeff.robbins@cchmc.org Accepted 2015-JUN-02 by ORCHARD Journal of molecular and cellular cardiology 2012 imex curation actc_mouse Actin, alpha cardiac muscle 1 Actc1 Actc Alpha-cardiac actin protein protein mouse Mus musculus Mouse MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF E5C10FA19730CAD2 mypc3_mouse Myosin-binding protein C, cardiac-type Mybpc3 C-protein, cardiac muscle isoform protein protein mouse Mus musculus Mouse MPEPGKKPVSAFNKKPRSAEVTAGSAAVFEAETERSGVMVRWQRDGSDITANDKYGLAAEGKRHTLTVRDASPDDQGSYAVIAGSSKVKFDLKVTEPAPPEKAESEVAPGAPEEVPAPATELEESVSSPEGSVSVTQDGSAAEHQGAPDDPIGLFLMRPQDGEVTVGGSIVFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQTTSAGGYRCEVSTKDKFDSCNFNLTVHEAIGSGDLDLRSAFRRTSLAGAGRRTSDSHEDAGTPDFSSLLKKRDSFRRDSKLEAPAEEDVWEILRQAPPSEYERIAFQHGVEACHRPLKRLKGMKQDEKKSTAFQKKLEPAYQVNKGHKIRLTVELADPDAEVKWLKNGQEIQMSGSKYIFESVGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRSLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGRKHHLIINEATLEDAGHYAVRTSGGQSLAELIVQEKKLEVYQSIADLAVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDNRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGSTPDTIVVVTGNKLRLDVPISGDPAPTVVWQKTVTQGKKASAGPHPDAPEDAGADEEWVFDKKLLCETEGRVRVETTKDRSVFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPVLGYILERKKKKSYRWMRLNFDLLRELSHEARRMIEGVAYEMRVYAVNAVGMSRPSPASQPFMPIGPPGEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCQEGCSEWTPALQGLTERRSMLVKDLPTGARLLFRVRAHNVAGPGGPIVTKEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRTHSGTYQVTVRIENMEDKATLILQIVDKPSPPQDIRIVETWGFNVALEWKPPQDDGNTEIWGYTVQKADKKTMEWFTVLEHYRRTHCVVSELIIGNGYYFRVFSHNMVGSSDKAAATKEPVFIPRPGITYEPPKYKALDFSEAPSFTQPLANRSIIAGYNAILCCAVRGSPKPKISWFKNGLDLGEDARFRMFCKQGVLTLEIRKPCPYDGGVYVCRATNLQGEAQCECRLEVRVPQ DIP protein O70468 original sequence version: 108 DIP protein O70468 original sequence version: 74 mint Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role 699947C3C9B58931 myh6_mouse Myosin-6 Myh6 Myhca Myosin heavy chain 6 Myosin heavy chain, cardiac muscle alpha isoform protein protein mouse Mus musculus Mouse MTDAQMADFGAAAQYLRKSEKERLEAQTRPFDIRTECFVPDDKEEYVKAKVVSREGGKVTAETENGKTVTIKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAIGDRSKKENPNANKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLDMLLVTNNPYDYAFVSQGEVSVASIDDSEELLATDSAFDVLSFTAEEKAGVYKLTGAIMHYGNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQVYYSIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDMTFKAKLYDNHLGKSNNFQKPRNVKGKQEAHFSLVHYAGTVDYNIMGWLEKNKDPLNETVVGLYQKSSLKLMATLFSTYASADTGDSGKGKGGKKKGSSFQTVSALHRENLNKLMTNLKTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQARGQLMRIEFKKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMANMKEEFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLNDAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDISQQNSKIEDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALQSSRHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKNVHELEKIRKQLEVEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRMVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSQANRIASEAQKHLKNSQAHLKDTQLQLDDAVHANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDKKNLMRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKSRDIGAKKMHDEE DIP protein Q02566 original sequence version: 127 EAD789ADA68818FB mybpc3-actc1-3 2 4 unspecified role unspecified role bait bait O70468:p.[Lys188Ala;Lys191Ala;Lys193Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain K A Fri Jul 22 10:58:08 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys191ala,lys193ala,lys188ala' Wed May 02 14:32:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys188ala,lys191ala,lys193ala' Tue Jun 30 17:08:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys188Ala;Lys191Ala;Lys193Ala]' region sufficient to bind sufficient binding region sufficient to bind range range range range undefined mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength range range range range Wed Jul 06 16:35:59 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'region' N/A opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm O70468:p.Arg279_Thr281delinsAlaAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain RRT AAA Wed May 02 19:08:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_arg_thr279-281ala_ala_ala' Tue Jun 30 17:00:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg279_Thr281delinsAlaAlaAla' O70468:p.Arg279_Arg280delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain RR AA Wed May 02 18:28:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_arg279-280ala_ala' Tue Jun 30 17:56:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg279_Arg280delinsAlaAla' O70468:p.Arg304_Arg305delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain RR AA Wed May 02 20:30:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_arg304-305ala_ala' Tue Jun 30 18:29:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg304_Arg305delinsAlaAla' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role prey prey physical association physical association 1B, 2C, 3B, Supp fig 1B, 2. Numbering for the M region taken from figure 3 The M and C1 regions bind actin independently of one another. A fragment containing the binding domain in M, but linked to C2, does not interact. mybpc3-myh6-1 2 4 unspecified role unspecified role bait bait O70468:p.[Lys188Ala;Lys191Ala;Lys193Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain K A Fri Jul 22 10:58:55 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys191ala,lys193ala,lys188ala' Wed May 02 17:26:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys188ala,lys191ala,lys193ala' Tue Jun 30 17:02:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys188Ala;Lys191Ala;Lys193Ala]' region sufficient to bind sufficient binding region sufficient to bind range range range range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain N/A opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm O70468:p.[Arg266Ala;Arg270_Arg271delinsAlaAla] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain RR AA Fri Jul 22 10:56:57 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'N/A' Wed May 02 15:03:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg266ala,arg_arg270-271ala_ala' Tue Jun 30 19:45:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg266Ala;Arg270_Arg271delinsAlaAla]' O70468:p.Arg279_Thr281delinsAlaAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain RRT AAA Wed May 02 16:26:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_arg_thr279-281ala_ala_ala' Tue Jun 30 17:35:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg279_Thr281delinsAlaAlaAla' O70468:p.Lys298_Arg300delinsAlaAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain KKR AAA Wed May 02 15:49:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys_lys_arg298-300ala_ala_ala' Tue Jun 30 15:44:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys298_Arg300delinsAlaAlaAla' O70468:p.Lys298_Lys299delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain KK AA Wed May 02 19:55:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys_lys298-299ala_ala' Tue Jun 30 20:03:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys298_Lys299delinsAlaAla' 5 unspecified role unspecified role prey prey S2_domain sufficient to bind sufficient binding region sufficient to bind range range range range 28 20 physical association physical association 1D, 2D, 3C "m" region numbering from figure 3 mybpc3-myh11-1 1 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain N/A opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm 3 inhibitor inhibitor ancillary ancillary 5 unspecified role unspecified role prey prey S2_domain sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association Supp Fig 6B, 3D/E "m" region numbering from figure 3 mybpc3-actc1-2 1 4 unspecified role unspecified role bait bait N/A opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 inhibitor inhibitor ancillary ancillary S2_domain sufficient to bind sufficient binding region sufficient to bind range range range range 3 unspecified role unspecified role prey prey physical association physical association Supp Fig 6A, 3D/E Numbering for the M region taken from figure 3