IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Crystal structure of the human NKX2.5 homeodomain in complex with DNA target. Crystal structure of the human NKX2.5 homeodomain in complex with DNA target. Biochemistry (0006-2960) 2012 imex curation Pradhan L., Genis C., Scone P., Weinberg E.O., Kasahara H., Nam H.J. Cardiac - Interactions involving cardiac related proteins hnam@utdallas.edu Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pradhan L., Genis C., Scone P., Weinberg E.O., Kasahara H., Nam H.J. Cardiac - Interactions involving cardiac related proteins hnam@utdallas.edu Accepted 2015-MAR-13 by ORCHARD Biochemistry (0006-2960) 2012 imex curation I added IPR001356 (Homeobox domain) as more specific term, I think. nkx25_human Homeobox protein Nkx-2.5 NKX2-5 CSX NKX2.5 NKX2E Homeobox protein NK-2 homolog E Cardiac-specific homeobox Homeobox protein CSX protein protein human Homo sapiens Human MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW ACCC9C2F9C292586 afn promoter AFN proximal promoter ds dna double stranded deoxyribonucleic acid ds DNA ds dna human Homo sapiens Human TGAAGTGGGGGCCTCTTGA nkx2_5-nppa-1 1 2 unspecified role unspecified role neutral component neutral component homeodomain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component synthetic construct synthetic construct direct interaction direct interaction Fig.2, Table 1 1.7 Angstrom Rwork = 0.21 Rfree = 0.26