bhf-ucl HEB and E2A function as SMAD/FOXH1 cofactors. HEB and E2A function as SMAD/FOXH1 cofactors. Genes Dev. (0890-9369) 2011 imex curation Yoon S.J., Wills A.E., Chuong E., Gupta R., Baker J.C. Cardiac - Interactions involving cardiac related proteins jbaker@stanford.edu 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions human-endoerm Human endoderm endoderm endoderm anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yoon S.J., Wills A.E., Chuong E., Gupta R., Baker J.C. Cardiac - Interactions involving cardiac related proteins Note there is no information about whether the antibodies are monoclonal or polyclonal, even in Supplemental files jbaker@stanford.edu Accepted 2014-JUN-06 by ORCHARD Genes Dev. (0890-9369) 2011 imex curation HEB and E2A function as SMAD/FOXH1 cofactors. HEB and E2A function as SMAD/FOXH1 cofactors. Genes Dev. (0890-9369) 2011 imex curation Yoon S.J., Wills A.E., Chuong E., Gupta R., Baker J.C. Cardiac - Interactions involving cardiac related proteins jbaker@stanford.edu 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions human-embryonic_stem_ cells Human-embryonic_stem_ cells (es cells) embryonic_stem_cell Embryonic stem cell (es cells) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yoon S.J., Wills A.E., Chuong E., Gupta R., Baker J.C. Cardiac - Interactions involving cardiac related proteins Note there is no information about whether the antibodies are monoclonal or polyclonal, even in Supplemental files jbaker@stanford.edu Accepted 2014-JUN-06 by ORCHARD Genes Dev. (0890-9369) 2011 imex curation tfe2_human Transcription factor E2-alpha Immunoglobulin enhancer-binding factor E12/E47 Transcription factor 3 Immunoglobulin transcription factor 1 Transcription factor ITF-1 Kappa-E2-binding factor TCF3 E2A ITF1 BHLHB21 Class B basic helix-loop-helix protein 21 protein protein human Homo sapiens Human MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTYPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM DIP protein P15923 original sequence version: 171 DIP protein P15923 original sequence version: 132 DIP protein P15923 original sequence version: 126 52F5E3DE1890AE13 foxh1_human Forkhead box protein H1 FOXH1 FAST1 FAST2 Forkhead activin signal transducer 1 Forkhead activin signal transducer 2 protein protein human Homo sapiens Human MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAPSRRLKLAQIIRQVQAVFPFFREDYEGWKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNGGARGAFAKDLGPYVLHGRPYRPPSPPPPPSEGFSIKSLLGGSGEGAPWPGLAPQSSPVPAGTGNSGEEAVPTPPLPSSERPLWPLCPLPGPTRVEGETVQGGAIGPSTLSPEPRAWPLHLLQGTAVPGGRSSGGHRASLWGQLPTSYLPIYTPNVVMPLAPPPTSCPQCPSTSPAYWGVAPETRGPPGLLCDLDALFQGVPPNKSIYDVWVSHPRDLAAPGPGWLLSWCSL 27A13F39C089F722 smad3_human Mothers against decapentaplegic homolog 3 SMAD3 MADH3 SMAD family member 3 JV15-2 protein protein human Homo sapiens Human MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS DIP protein P84022 original sequence version: 57 DIP protein P84022 original sequence version: 112 DIP protein P84022-1 original sequence version: 146 DIP protein P84022-1 original sequence version: 111 46DF5E8B371321AC htf4_human Transcription factor 12 Transcription factor HTF-4 E-box-binding protein DNA-binding protein HTF4 TCF12 HEB HTF4 BHLHB20 Class B basic helix-loop-helix protein 20 protein protein human Homo sapiens Human MNPQQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDERGGTTSWGTSGQPSPSYDSSRGFTDSPHYSDHLNDSRLGAHEGLSPTPFMNSNLMGKTSERGSFSLYSRDTGLPGCQSSLLRQDLGLGSPAQLSSSGKPGTAYYSFSATSSRRRPLHDSAALDPLQAKKVRKVPPGLPSSVYAPSPNSDDFNRESPSYPSPKPPTSMFASTFFMQDGTHNSSDLWSSSNGMSQPGFGGILGTSTSHMSQSSSYGNLHSHDRLSYPPHSVSPTDINTSLPPMSSFHRGSTSSSPYVAASHTPPINGSDSILGTRGNAAGSSQTGDALGKALASIYSPDHTSSSFPSNPSTPVGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLQSRMEDRLDRLDDAIHVLRNHAVGPSTSLPAGHSDIHSLLGPSHNAPIGSLNSNYGGSSLVASSRSASMVGTHREDSVSLNGNHSVLSSTVTTSSTDLNHKTQENYRGGLQSQSGTVVTTEIKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSSRGRTSSTNEDEDLNPEQKIEREKERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSAVSAEPPTTLPGTHPGLSETTNPMGHM DIP protein Q99081 original sequence version: 135 DIP protein Q99081 original sequence version: 56 DIP protein Q99081 original sequence version: 91 DIP protein Q99081 original sequence version: 85 9736113D9361D3F5 smad3-foxh1 2 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Fig 2C smad3-tcf3 2 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Fig 2C tcf3-foxh1-1 2 HEB 6 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Fig 2C smad3-tcf12 2 HEB 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Fig 2C foxh1-smad3 2 HEB 6 unspecified role unspecified role prey prey 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait cell lysate cell lysate physical association physical association Fig 2C smad3-tcf3-1 1 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Fig 2C tcf12-foxh1 1 HEB 6 unspecified role unspecified role bait bait 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association Fig 2C