IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A novel desmocollin-2 mutation reveals insights into the molecular link between desmosomes and gap junctions. A novel desmocollin-2 mutation reveals insights into the molecular link between desmosomes and gap junctions. Heart Rhythm (1547-5271) 2011 imex curation Gehmlich K., Lambiase P.D., Asimaki A., Ciaccio E.J., Ehler E., Syrris P., Saffitz J.E., McKenna W.J. Cardiac - Interactions involving cardiac related proteins This experiment relates to a negative interaction. I have not included "co-locs" Supp Fig 4 C+D as Plakoglobin in this instance is a "marker" only. PLEASE remove the "cautions" at EXPERIMENT levels for the NEGATIVE interactions - I have left them in, as it makes it easier to see which Expts are negative without having to go into annotations for each..... katja.gehmlich@cardiov.ox.ac.uk 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Gehmlich K., Lambiase P.D., Asimaki A., Ciaccio E.J., Ehler E., Syrris P., Saffitz J.E., McKenna W.J. Cardiac - Interactions involving cardiac related proteins This experiment relates to a negative interaction. I have not included "co-locs" Supp Fig 4 C+D as Plakoglobin in this instance is a "marker" only. PLEASE remove the "cautions" at EXPERIMENT levels for the NEGATIVE interactions - I have left them in, as it makes it easier to see which Expts are negative without having to go into annotations for each..... katja.gehmlich@cardiov.ox.ac.uk Accepted 2013-SEP-09 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. Heart Rhythm (1547-5271) 2011 Only protein-protein interactions imex curation A novel desmocollin-2 mutation reveals insights into the molecular link between desmosomes and gap junctions. A novel desmocollin-2 mutation reveals insights into the molecular link between desmosomes and gap junctions. Heart Rhythm (1547-5271) 2011 imex curation Gehmlich K., Lambiase P.D., Asimaki A., Ciaccio E.J., Ehler E., Syrris P., Saffitz J.E., McKenna W.J. Cardiac - Interactions involving cardiac related proteins This experiment relates to a negative interaction. I have not included "co-locs" Supp Fig 4 C+D as Plakoglobin in this instance is a "marker" only. PLEASE remove the "cautions" at EXPERIMENT levels for the NEGATIVE interactions - I have left them in, as it makes it easier to see which Expts are negative without having to go into annotations for each..... katja.gehmlich@cardiov.ox.ac.uk 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 pull down pull down western blot western blot Immuno blot Immuno blot Gehmlich K., Lambiase P.D., Asimaki A., Ciaccio E.J., Ehler E., Syrris P., Saffitz J.E., McKenna W.J. Cardiac - Interactions involving cardiac related proteins This experiment relates to a negative interaction. I have not included "co-locs" Supp Fig 4 C+D as Plakoglobin in this instance is a "marker" only. PLEASE remove the "cautions" at EXPERIMENT levels for the NEGATIVE interactions - I have left them in, as it makes it easier to see which Expts are negative without having to go into annotations for each..... katja.gehmlich@cardiov.ox.ac.uk Accepted 2013-SEP-09 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. Heart Rhythm (1547-5271) 2011 Only protein-protein interactions imex curation A novel desmocollin-2 mutation reveals insights into the molecular link between desmosomes and gap junctions. A novel desmocollin-2 mutation reveals insights into the molecular link between desmosomes and gap junctions. Heart Rhythm (1547-5271) 2011 imex curation Gehmlich K., Lambiase P.D., Asimaki A., Ciaccio E.J., Ehler E., Syrris P., Saffitz J.E., McKenna W.J. Cardiac - Interactions involving cardiac related proteins This experiment relates to a negative interaction. I have not included "co-locs" Supp Fig 4 C+D as Plakoglobin in this instance is a "marker" only. PLEASE remove the "cautions" at EXPERIMENT levels for the NEGATIVE interactions - I have left them in, as it makes it easier to see which Expts are negative without having to go into annotations for each..... katja.gehmlich@cardiov.ox.ac.uk 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gehmlich K., Lambiase P.D., Asimaki A., Ciaccio E.J., Ehler E., Syrris P., Saffitz J.E., McKenna W.J. Cardiac - Interactions involving cardiac related proteins This experiment relates to a negative interaction. I have not included "co-locs" Supp Fig 4 C+D as Plakoglobin in this instance is a "marker" only. PLEASE remove the "cautions" at EXPERIMENT levels for the NEGATIVE interactions - I have left them in, as it makes it easier to see which Expts are negative without having to go into annotations for each..... katja.gehmlich@cardiov.ox.ac.uk Accepted 2013-SEP-09 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. Heart Rhythm (1547-5271) 2011 Only protein-protein interactions imex curation A novel desmocollin-2 mutation reveals insights into the molecular link between desmosomes and gap junctions. A novel desmocollin-2 mutation reveals insights into the molecular link between desmosomes and gap junctions. Heart Rhythm (1547-5271) 2011 imex curation Gehmlich K., Lambiase P.D., Asimaki A., Ciaccio E.J., Ehler E., Syrris P., Saffitz J.E., McKenna W.J. Cardiac - Interactions involving cardiac related proteins This experiment relates to a negative interaction. I have not included "co-locs" Supp Fig 4 C+D as Plakoglobin in this instance is a "marker" only. PLEASE remove the "cautions" at EXPERIMENT levels for the NEGATIVE interactions - I have left them in, as it makes it easier to see which Expts are negative without having to go into annotations for each..... katja.gehmlich@cardiov.ox.ac.uk 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions rat-cardiac_myocytes_neo rat cardiac myocytes neo neonatal_ventricular_myocyte neonatal ventricular myocyte confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Gehmlich K., Lambiase P.D., Asimaki A., Ciaccio E.J., Ehler E., Syrris P., Saffitz J.E., McKenna W.J. Cardiac - Interactions involving cardiac related proteins This experiment relates to a negative interaction. I have not included "co-locs" Supp Fig 4 C+D as Plakoglobin in this instance is a "marker" only. PLEASE remove the "cautions" at EXPERIMENT levels for the NEGATIVE interactions - I have left them in, as it makes it easier to see which Expts are negative without having to go into annotations for each..... katja.gehmlich@cardiov.ox.ac.uk Accepted 2013-SEP-09 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. Heart Rhythm (1547-5271) 2011 Only protein-protein interactions imex curation A novel desmocollin-2 mutation reveals insights into the molecular link between desmosomes and gap junctions. A novel desmocollin-2 mutation reveals insights into the molecular link between desmosomes and gap junctions. Heart Rhythm (1547-5271) 2011 imex curation Gehmlich K., Lambiase P.D., Asimaki A., Ciaccio E.J., Ehler E., Syrris P., Saffitz J.E., McKenna W.J. Cardiac - Interactions involving cardiac related proteins This experiment relates to a negative interaction. I have not included "co-locs" Supp Fig 4 C+D as Plakoglobin in this instance is a "marker" only. PLEASE remove the "cautions" at EXPERIMENT levels for the NEGATIVE interactions - I have left them in, as it makes it easier to see which Expts are negative without having to go into annotations for each..... katja.gehmlich@cardiov.ox.ac.uk 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gehmlich K., Lambiase P.D., Asimaki A., Ciaccio E.J., Ehler E., Syrris P., Saffitz J.E., McKenna W.J. Cardiac - Interactions involving cardiac related proteins This experiment relates to a negative interaction. I have not included "co-locs" Supp Fig 4 C+D as Plakoglobin in this instance is a "marker" only. PLEASE remove the "cautions" at EXPERIMENT levels for the NEGATIVE interactions - I have left them in, as it makes it easier to see which Expts are negative without having to go into annotations for each..... katja.gehmlich@cardiov.ox.ac.uk Accepted 2013-SEP-09 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. Heart Rhythm (1547-5271) 2011 Only protein-protein interactions imex curation A novel desmocollin-2 mutation reveals insights into the molecular link between desmosomes and gap junctions. A novel desmocollin-2 mutation reveals insights into the molecular link between desmosomes and gap junctions. Heart Rhythm (1547-5271) 2011 imex curation Gehmlich K., Lambiase P.D., Asimaki A., Ciaccio E.J., Ehler E., Syrris P., Saffitz J.E., McKenna W.J. Cardiac - Interactions involving cardiac related proteins This experiment relates to a negative interaction. I have not included "co-locs" Supp Fig 4 C+D as Plakoglobin in this instance is a "marker" only. PLEASE remove the "cautions" at EXPERIMENT levels for the NEGATIVE interactions - I have left them in, as it makes it easier to see which Expts are negative without having to go into annotations for each..... katja.gehmlich@cardiov.ox.ac.uk 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Gehmlich K., Lambiase P.D., Asimaki A., Ciaccio E.J., Ehler E., Syrris P., Saffitz J.E., McKenna W.J. Cardiac - Interactions involving cardiac related proteins This experiment relates to a negative interaction. I have not included "co-locs" Supp Fig 4 C+D as Plakoglobin in this instance is a "marker" only. PLEASE remove the "cautions" at EXPERIMENT levels for the NEGATIVE interactions - I have left them in, as it makes it easier to see which Expts are negative without having to go into annotations for each..... katja.gehmlich@cardiov.ox.ac.uk Accepted 2013-SEP-09 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. Heart Rhythm (1547-5271) 2011 Only protein-protein interactions imex curation A novel desmocollin-2 mutation reveals insights into the molecular link between desmosomes and gap junctions. A novel desmocollin-2 mutation reveals insights into the molecular link between desmosomes and gap junctions. Heart Rhythm (1547-5271) 2011 imex curation Gehmlich K., Lambiase P.D., Asimaki A., Ciaccio E.J., Ehler E., Syrris P., Saffitz J.E., McKenna W.J. Cardiac - Interactions involving cardiac related proteins This experiment relates to a negative interaction. I have not included "co-locs" Supp Fig 4 C+D as Plakoglobin in this instance is a "marker" only. PLEASE remove the "cautions" at EXPERIMENT levels for the NEGATIVE interactions - I have left them in, as it makes it easier to see which Expts are negative without having to go into annotations for each..... katja.gehmlich@cardiov.ox.ac.uk 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 pull down pull down anti tag western anti tag western blot anti tag western Gehmlich K., Lambiase P.D., Asimaki A., Ciaccio E.J., Ehler E., Syrris P., Saffitz J.E., McKenna W.J. Cardiac - Interactions involving cardiac related proteins This experiment relates to a negative interaction. I have not included "co-locs" Supp Fig 4 C+D as Plakoglobin in this instance is a "marker" only. PLEASE remove the "cautions" at EXPERIMENT levels for the NEGATIVE interactions - I have left them in, as it makes it easier to see which Expts are negative without having to go into annotations for each..... katja.gehmlich@cardiov.ox.ac.uk Accepted 2013-SEP-09 by PPORRAS 30-Sept-2013: Contacted by IntAct-Help. Heart Rhythm (1547-5271) 2011 Only protein-protein interactions imex curation jup_chlae_protein Green monkey plakoglobin protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey cxa1_chlae Gap junction alpha-1 protein GJA1 Connexin-43 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGCENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSIFEVAFLLIQWYIYGFSLSAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVKGKSDPYHTTSGALSPTKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI 3CDDADE7412D408A cxa1_human Gap junction alpha-1 protein GJAL Connexin-43 Gap junction 43 kDa heart protein GJA1 protein protein human Homo sapiens Human MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGCENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVDMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSIFEVAFLLIQWYIYGFSLSAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI 7DDDAD8040284176 plak_rat Junction plakoglobin Jup protein protein rat Rattus norvegicus (Rat) Rat MEVMNLIEQPIKVTEWQQTYTYDSGIHSGVNTCVPSVSSKGLLDEDDTCGRQYTLKKTTTYTQGVPQSQGDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQTTNLQRLAEPSQLLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQESKLIILANGGPQGLVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKHLTSNSPRLVQNCLWTLRNLSDVATKQEGLENVLKILVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDYRKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYADDMDATYRPMYSSDVPLDPLDMHMDMDGDYPMDTYSDGLRPPYPAADHMLA BF8673E1B797954D q02487-1 Desmocollin-2 DGII DSC2 CDHF2 DSC3 Cadherin family member 2 Desmocollin-3 Desmosomal glycoprotein II Desmosomal glycoprotein III protein protein human Homo sapiens Human MEAARPSGSWNGALCRLLLLTLAILIFASDACKNVTLHVPSKLDAEKLVGRVNLKECFTAANLIHSSDPDFQILEDGSVYTTNTILLSSEKRSFTILLSNTENQEKKKIFVFLEHQTKVLKKRHTKEKVLRRAKRRWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQEPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNYPIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQVPPSPTLFSMHPTTGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINIDDVNDHLPTFTRTSYVTSVEENTVDVEILRVTVEDKDLVNTANWRANYTILKGNENGNFKIVTDAKTNEGVLCVVKPLNYEEKQQMILQIGVVNEAPFSREASPRSAMSTATVTVNVEDQDEGPECNPPIQTVRMKENAEVGTTSNGYKAYDPETRSSSGIRYKKLTDPTGWVTIDENTGSIKVFRSLDREAETIKNGIYNITVLASDQGGRTCTGTLGIILQDVNDNSPFIPKKTVIICKPTMSSAEIVAVDPDEPIHGPPFDFSLESSTSEVQRMWRLKAINDTAARLSYQNDPPFGSYVVPITVRDRLGMSSVTSLDVTLCDCITENDCTHRVDPRIGGGGVQLGKWAILAILLGIALLFCILFTLVCGASGTSKQPKVIPDDLAQQNLIVSNTEAPGDDKVYSANGFTTQTVGASAQGVCGTVGSGIKNGGQETIEMVKGGHQTSESCRGAGHHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPRLGEKVYLCNQDENHKHAQDYVLTYNYEGRGSVAGSVGCCSERQEEDGLEFLDNLEPKFRTLAEACMKR 30F7E3D33ECA67CC f1m7l9_rat protein protein rat Rattus norvegicus (Rat) Rat MAIPGSLGECGYIRTVLGQQILGHLDSSSLALPSEARLRLAGSSGRGDPVARSQRIQEQVQQTLARRGRSSVVGGNLHRTSSVPEYVYKLHLVENDFVGRQSPAARDYDMQKTYLTSSFVSGWRDGSTLNSIKPHREKKTWIEALRELEHTTDHTDCPAHYVYSHYYFNTRSHIVSSGKKKLAVILLSRILKLSRSCTHQLAPLRSSVLPSLFNQLQLSPELYFSNMGTLYSSYQLLKGKLPAKHQANFVTMAERSVAVKFPDTSSETSFRRTGDTLPSAWQSRVHGLHFHHVICDCLSRNADLEMTLERAVNMLDADHVPLSKISAAATFIQHESFQKSEARKRVTKCQCVYSTLQYKQCQNSDEDSRECGELRSLVLRDNDPKVNITKREGGGQAAGYMKETFKIEANKNITGLLWNLSSSDKLKHLMITEALLTLTESVIIPFSGWPEGDYPKANGLLDFDIFYNVTGCLRNMSSAGPDGRKVMRRCDGLIDSLVHYVRGTIADYQPDDKATENCVCILHNLSYQLEAELPEKYSQSIYMQNRNIQTNSNKSIGCFGSRSRKVKEQYQDTPMPEERSSPRGIEWLWHSIVIRMYLSLIAKSSRNYTQEASLGALQNLTAGSGPIPTSVARMVVQKENGLQHTRKMLHVGDPSVKKTAVSLLRNLSRNLSLQNEIAKETLPDLVSIIPDTVPSTDLLIETTASACYTLNNLMQNSYQNARDLLNTGGLQKIMTISIGEGYAPNKASKAASVLLYSLWAHTELHNAYKKAQFKKTDFVNSRTAKASHSLKD 62A7FEC65C41C253 dsg2_human Desmoglein-2 CDHF5 HDGC Cadherin family member 5 DSG2 protein protein human Homo sapiens Human MARSPGRAYALLLLLICFNVGSGLHLQVLSTRNENKLLPKHPHLVRQKRAWITAPVALREGEDLSKKNPIAKIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREETPFFLLTGYALDARGNNVEKPLELRIKVLDINDNEPVFTQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYRIVSLEPAYPPVFYLNKDTGEIYTTSVTLDREEHSSYTLTVEARDGNGEVTDKPVKQAQVQIRILDVNDNIPVVENKVLEGMVEENQVNVEVTRIKVFDADEIGSDNWLANFTFASGNEGGYFHIETDAQTNEGIVTLIKEVDYEEMKNLDFSVIVANKAAFHKSIRSKYKPTPIPIKVKVKNVKEGIHFKSSVISIYVSESMDRSSKGQIIGNFQAFDEDTGLPAHARYVKLEDRDNWISVDSVTSEIKLAKLPDFESRYVQNGTYTVKIVAISEDYPRKTITGTVLINVEDINDNCPTLIEPVQTICHDAEYVNVTAEDLDGHPNSGPFSFSVIDKPPGMAEKWKIARQESTSVLLQQSEKKLGRSEIQFLISDNQGFSCPEKQVLTLTVCECLHGSGCREAQHDSYVGLGPAAIALMILAFLLLLLVPLLLLMCHCGKGAKGFTPIPGTIEMLHPWNNEGAPPEDKVVPSFLPVDQGGSLVGRNGVGGMAKEATMKGSSSASIVKGQHEMSEMDGRWEEHRSLLSGRATQFTGATGAIMTTETTKTARATGASRDMAGAQAAAVALNEEFLRNYFTDKAASYTEEDENHTAKDCLLVYSQEETESLNASIGCCSFIEGELDDRFLDDLGLKFKTLAEVCLGQKIDINKEIEQRQKPATETSMNTASHSLCEQTMVNSENTYSSGSSFPVPKSLQEANAEKVTQEIVTERSVSSRQAQKVATPLPDPMASRNVIATETSYVTGSTMPPTTVILGPSQPQSLIVTERVYAPASTLVDQPYANEGTVVVTERVIQPHGGGSNPLEGTQHLQDVPYVMVRERESFLAPSSGVQPTLAMPNIAVGQNVTVTERVLAPASTLQSSYQIPTENSMTARNTTVSGAGVPGPLPDFGLEESGHSNSTITTSSTRVTKHSTVQHSYS DIP protein Q14126 original sequence version: 76 E1481AA1686DB80A desp_human Desmoplakin DSP 250/210 kDa paraneoplastic pemphigus antigen protein protein human Homo sapiens Human MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQLYINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMFGDDDKRKIQSQFTDAQKHYQTLVIQLPGYPQHQTVTTTEITHHGTCQDVNHNKVIETNRENDKQETWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSHHITVKINELKSVQNDSQAIAEVLNQLKDMLANFRGSEKYCYLQNEVFGLFQKLENINGVTDGYLNSLCTVRALLQAILQTEDMLKVYEARLTEEETVCLDLDKVEAYRCGLKKIKNDLNLKKSLLATMKTELQKAQQIHSQTSQQYPLYDLDLGKFGEKVTQLTDRWQRIDKQIDFRLWDLEKQIKQLRNYRDNYQAFCKWLYDAKRRQDSLESMKFGDSNTVMRFLNEQKNLHSEISGKRDKSEEVQKIAELCANSIKDYELQLASYTSGLETLLNIPIKRTMIQSPSGVILQEAADVHARYIELLTRSGDYYRFLSEMLKSLEDLKLKNTKIEVLEEELRLARDANSENCNKNKFLDQNLQKYQAECSQFKAKLASLEELKRQAELDGKSAKQNLDKCYGQIKELNEKITRLTYEIEDEKRRRKSVEDRFDQQKNDYDQLQKARQCEKENLGWQKLESEKAIKEKEYEIERLRVLLQEEGTRKREYENELAKVRNHYNEEMSNLRNKYETEINITKTTIKEISMQKEDDSKNLRNQLDRLSRENRDLKDEIVRLNDSILQATEQRRRAEENALQQKACGSEIMQKKQHLEIELKQVMQQRSEDNARHKQSLEEAAKTIQDKNKEIERLKAEFQEEAKRRWEYENELSKVRNNYDEEIISLKNQFETEINITKTTIHQLTMQKEEDTSGYRAQIDNLTRENRSLSEEIKRLKNTLTQTTENLRRVEEDIQQQKATGSEVSQRKQQLEVELRQVTQMRTEESVRYKQSLDDAAKTIQDKNKEIERLKQLIDKETNDRKCLEDENARLQRVQYDLQKANSSATETINKLKVQEQELTRLRIDYERVSQERTVKDQDITRFQNSLKELQLQKQKVEEELNRLKRTASEDSCKRKKLEEELEGMRRSLKEQAIKITNLTQQLEQASIVKKRSEDDLRQQRDVLDGHLREKQRTQEELRRLSSEVEALRRQLLQEQESVKQAHLRNEHFQKAIEDKSRSLNESKIEIERLQSLTENLTKEHLMLEEELRNLRLEYDDLRRGRSEADSDKNATILELRSQLQISNNRTLELQGLINDLQRERENLRQEIEKFQKQALEASNRIQESKNQCTQVVQERESLLVKIKVLEQDKARLQRLEDELNRAKSTLEAETRVKQRLECEKQQIQNDLNQWKTQYSRKEEAIRKIESEREKSEREKNSLRSEIERLQAEIKRIEERCRRKLEDSTRETQSQLETERSRYQREIDKLRQRPYGSHRETQTECEWTVDTSKLVFDGLRKKVTAMQLYECQLIDKTTLDKLLKGKKSVEEVASEIQPFLRGAGSIAGASASPKEKYSLVEAKRKKLISPESTVMLLEAQAATGGIIDPHRNEKLTVDSAIARDLIDFDDRQQIYAAEKAITGFDDPFSGKTVSVSEAIKKNLIDRETGMRLLEAQIASGGVVDPVNSVFLPKDVALARGLIDRDLYRSLNDPRDSQKNFVDPVTKKKVSYVQLKERCRIEPHTGLLLLSVQKRSMSFQGIRQPVTVTELVDSGILRPSTVNELESGQISYDEVGERIKDFLQGSSCIAGIYNETTKQKLGIYEAMKIGLVRPGTALELLEAQAATGFIVDPVSNLRLPVEEAYKRGLVGIEFKEKLLSAERAVTGYNDPETGNIISLFQAMNKELIEKGHGIRLLEAQIATGGIIDPKESHRLPVDIAYKRGYFNEELSEILSDPSDDTKGFFDPNTEENLTYLQLKERCIKDEETGLCLLPLKEKKKQVQTSQKNTLRKRRVVIVDPETNKEMSVQEAYKKGLIDYETFKELCEQECEWEEITITGSDGSTRVVLVDRKTGSQYDIQDAIDKGLVDRKFFDQYRSGSLSLTQFADMISLKNGVGTSSSMGSGVSDDVFSSSRHESVSKISTISSVRNLTIRSSSFSDTLEESSPIAAIFDTENLEKISITEGIERGIVDSITGQRLLEAQACTGGIIHPTTGQKLSLQDAVSQGVIDQDMATRLKPAQKAFIGFEGVKGKKKMSAAEAVKEKWLPYEAGQRFLEFQYLTGGLVDPEVHGRISTEEAIRKGFIDGRAAQRLQDTSSYAKILTCPKTKLKISYKDAINRSMVEDITGLRLLEAASVSSKGLPSPYNMSSAPGSRSGSRSGSRSGSRSGSRSGSRRGSFDATGNSSYSYSYSFSSSSIGH DIP protein P15924 original sequence version: 137 5770CC6B4F9F9F7B dsc2_human Desmocollin-2 DSC2 CDHF2 DSC3 Cadherin family member 2 Desmocollin-3 Desmosomal glycoprotein II Desmosomal glycoprotein III protein protein human Homo sapiens Human MEAARPSGSWNGALCRLLLLTLAILIFASDACKNVTLHVPSKLDAEKLVGRVNLKECFTAANLIHSSDPDFQILEDGSVYTTNTILLSSEKRSFTILLSNTENQEKKKIFVFLEHQTKVLKKRHTKEKVLRRAKRRWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQEPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNYPIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQVPPSPTLFSMHPTTGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINIDDVNDHLPTFTRTSYVTSVEENTVDVEILRVTVEDKDLVNTANWRANYTILKGNENGNFKIVTDAKTNEGVLCVVKPLNYEEKQQMILQIGVVNEAPFSREASPRSAMSTATVTVNVEDQDEGPECNPPIQTVRMKENAEVGTTSNGYKAYDPETRSSSGIRYKKLTDPTGWVTIDENTGSIKVFRSLDREAETIKNGIYNITVLASDQGGRTCTGTLGIILQDVNDNSPFIPKKTVIICKPTMSSAEIVAVDPDEPIHGPPFDFSLESSTSEVQRMWRLKAINDTAARLSYQNDPPFGSYVVPITVRDRLGMSSVTSLDVTLCDCITENDCTHRVDPRIGGGGVQLGKWAILAILLGIALLFCILFTLVCGASGTSKQPKVIPDDLAQQNLIVSNTEAPGDDKVYSANGFTTQTVGASAQGVCGTVGSGIKNGGQETIEMVKGGHQTSESCRGAGHHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPRLGEKVYLCNQDENHKHAQDYVLTYNYEGRGSVAGSVGCCSERQEEDGLEFLDNLEPKFRTLAEACMKR 30F7E3D33ECA67CC q02487-2 Desmocollin-2 DGIII DSC2 CDHF2 DSC3 Cadherin family member 2 Desmocollin-3 Desmosomal glycoprotein II Desmosomal glycoprotein III protein protein human Homo sapiens Human MEAARPSGSWNGALCRLLLLTLAILIFASDACKNVTLHVPSKLDAEKLVGRVNLKECFTAANLIHSSDPDFQILEDGSVYTTNTILLSSEKRSFTILLSNTENQEKKKIFVFLEHQTKVLKKRHTKEKVLRRAKRRWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQEPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNYPIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQVPPSPTLFSMHPTTGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINIDDVNDHLPTFTRTSYVTSVEENTVDVEILRVTVEDKDLVNTANWRANYTILKGNENGNFKIVTDAKTNEGVLCVVKPLNYEEKQQMILQIGVVNEAPFSREASPRSAMSTATVTVNVEDQDEGPECNPPIQTVRMKENAEVGTTSNGYKAYDPETRSSSGIRYKKLTDPTGWVTIDENTGSIKVFRSLDREAETIKNGIYNITVLASDQGGRTCTGTLGIILQDVNDNSPFIPKKTVIICKPTMSSAEIVAVDPDEPIHGPPFDFSLESSTSEVQRMWRLKAINDTAARLSYQNDPPFGSYVVPITVRDRLGMSSVTSLDVTLCDCITENDCTHRVDPRIGGGGVQLGKWAILAILLGIALLFCILFTLVCGASGTSKQPKVIPDDLAQQNLIVSNTEAPGDDKVYSANGFTTQTVGASAQGVCGTVGSGIKNGGQETIEMVKGGHQTSESCRGAGHHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPRLGEESIRGHTLIKN A53588B1D490CD8F dsc2-jup 4 11 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component Q02487-1:p.Asp852_Val854delinsThrMetSer mutation mutation certain certain sequence position certain certain certain sequence position certain DYV TMS Thu Jul 07 12:18:02 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was asp852thr,tyr853met,val854ser Fri Jul 22 10:55:14 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asp852thr,tyr853met,val854ser' Wed May 02 18:57:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp_tyr_val852-854thr_met_ser' Tue Jun 30 17:00:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp852_Val854delinsThrMetSer' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) colocalization colocalization 4B The more complete version of the mutation is given in Fig 5A - it is not a simple deletion as might be assumed from earlier text. The partial nucleotide sequence for the mutant given in Fig 1A does (as far as it goes) align with the stated mutant amino acids in Fig 5A, so I assume Fig 5A is correct for the mutant sequence alterations. dsc2-jup-1 1 13 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] 12 unspecified role unspecified role bait bait cytoplasmic_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] association association 5B -wt dsc2-jup-2 1 13 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] 12 unspecified role unspecified role bait bait cytoplasmic_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q02487-1:p.Asp852_Val854delinsThrMetSer mutation mutation certain certain sequence position certain certain certain sequence position certain DYV TMS Thu Jul 07 12:18:24 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was asp852thr,tyr853met,val854ser Fri Jul 22 11:06:43 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asp852thr,tyr853met,val854ser' Wed May 02 20:01:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp_tyr_val852-854thr_met_ser' Tue Jun 30 20:25:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp852_Val854delinsThrMetSer' n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 5 B -mut DSC2b (and the mutant) bound only to PKP2 (Figure 5B). dsc2-pkp2 1 17 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range cytoplasmic_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] physical association physical association 5B-2b DSC2b (and the mutant) bound only to PKP2 (Figure 5B). dsc2-jup-4 5 12 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 5C -wt There was impaired binding of the DSC2a mutant full-length protein to plakoglobin. jup-dsc2 5 12 unspecified role unspecified role prey prey Q02487-1:p.Asp852_Val854delinsThrMetSer mutation mutation certain certain sequence position certain certain certain sequence position certain DYV TMS Thu Jul 07 12:18:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was asp852thr,tyr853met,val854ser Fri Jul 22 11:04:16 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asp852thr,tyr853met,val854ser' Wed May 02 15:28:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp_tyr_val852-854thr_met_ser' Tue Jun 30 15:46:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp852_Val854delinsThrMetSer' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait physical association physical association 6d mut There was impaired binding of the DSC2a mutant full-length protein. There appears to be weak binding between Cx43 and mutant DSC2a, in spite of the text stating there is no binding. dsc2-gja1 7 12 unspecified role unspecified role bait bait cytoplasmic_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role prey prey n_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 6A -wt dsc2-gja1-2 2 12 unspecified role unspecified role bait bait cytoplasmic_region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role prey prey physical association physical association 6B i have added the 2 mutants as a "required to bind" amalgam- and left out the 3 mutated residues - as this mutant really does not bind....(A897fsX900 is missing the last 5 amino acids) DSC2a WT bound to endogenous Cx43, and again the mutant DSC2a protein did not bind (Figure 6B) dsc2-gja1-3 2 9 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range cytoplasmic_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 6B -wt The text states that:- "DSC2a WT bound to endogenous Cx43, and again the mutant DSC2a protein and DSC2b did not bind (Figure 6B)." However a weak band is clearly visible for Dsc2b. IF the -2 isoform really did not bind, I would have added as a negative interaction (new Expt)- but I dont think this is justified. dsc2-gja1-4 6 10 unspecified role unspecified role prey prey cytoplasmic_c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 12 unspecified role unspecified role bait bait cytoplasmic_region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 6C i have added the mutant as a "required to bind" feature. gja1-dsc2 5 12 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 6D There was impaired binding of the DSC2a mutant full-length protein. dsc2-gja1-6 5 8 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q02487-1:p.Asp852_Val854delinsThrMetSer mutation mutation certain certain sequence position certain certain certain sequence position certain DYV TMS Thu Jul 07 12:18:03 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was asp852thr,tyr853met,val854ser Fri Jul 22 11:03:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asp852thr,tyr853met,val854ser' Wed May 02 14:47:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp_tyr_val852-854thr_met_ser' Tue Jun 30 18:27:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp852_Val854delinsThrMetSer' physical association physical association 5C mut There was impaired binding of the DSC2a mutant full-length protein. dsg2-dsc2 3 16 unspecified role unspecified role prey prey region_including_extracellular_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range 14 unspecified role unspecified role bait bait c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supp 4B, Supp 5B. I assume this is the -1 isoform for DSC2 as there is no mention of anything else in M+M (apart from mutant) under "Co-immunprecipitations". The A517V mutant shows normal binding to DSC2. Binding to DSG2 by mutant DSC2a (mediated by the extracellular portion) was preserved (Figure S5B). dsc2-gja1-7 7 15 unspecified role unspecified role prey prey ntp_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 12 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range cytoplasmic_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Supp 5A mutant is in the "required to bind" feature -as where the WT + mutant sequences differ (aa852) dsc2-jup-5 4 12 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component colocalization colocalization 4Bi The more complete version of the mutation is given in Fig 5A - it is not a simple deletion as might be assumed from earlier text. The partial nucleotide sequence for the mutant given in Fig 1A does (as far as it goes) align with the stated mutant amino acids in Fig 5A, so I assume Fig 5A is correct for the mutant sequence alterations.