bhf-ucl Sortilin associates with Trk receptors to enhance anterograde transport and neurotrophin signaling. Sortilin associates with Trk receptors to enhance anterograde transport and neurotrophin signaling. Nat. Neurosci. (1097-6256) 2011 imex curation Vaegter C.B., Jansen P., Fjorback A.W., Glerup S., Skeldal S., Kjolby M., Richner M., Erdmann B., Nyengaard J.R., Tessarollo L., Lewin G.R., Willnow T.E., Chao M.V., Nykjaer A. Cardiac - Interactions involving cardiac related proteins The TrK ectodomains used in the spr assay (Fig. 1d) were purchased from R and D Systems (688-TK-100). Information received from authors. Sortilin is of human origin and the aminoacid range of the extracellular domain used in the spr assay (Fig.1d) confirmed in PMID: 9927419 and by the author. All the proteins expressed in 293 cells are of human origin (confirmed by the authors) an@biokemi.au.dk, cv@biokemi.au.dk 12-Nov-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Vaegter C.B., Jansen P., Fjorback A.W., Glerup S., Skeldal S., Kjolby M., Richner M., Erdmann B., Nyengaard J.R., Tessarollo L., Lewin G.R., Willnow T.E., Chao M.V., Nykjaer A. Cardiac - Interactions involving cardiac related proteins The interaction detection method needs to be updated as soon as the correct term (FLIM- Fluorescence Lifetime Imaging Microscopy) is created The TrK ectodomains used in the spr assay (Fig. 1d) were purchased from R and D Systems (688-TK-100). Information received from authors. an@biokemi.au.dk, cv@biokemi.au.dk Accepted 2014-OCT-15 by ORCHARD Nat. Neurosci. (1097-6256) 2011 imex curation Sortilin associates with Trk receptors to enhance anterograde transport and neurotrophin signaling. Sortilin associates with Trk receptors to enhance anterograde transport and neurotrophin signaling. Nat. Neurosci. (1097-6256) 2011 imex curation Vaegter C.B., Jansen P., Fjorback A.W., Glerup S., Skeldal S., Kjolby M., Richner M., Erdmann B., Nyengaard J.R., Tessarollo L., Lewin G.R., Willnow T.E., Chao M.V., Nykjaer A. Cardiac - Interactions involving cardiac related proteins The TrK ectodomains used in the spr assay (Fig. 1d) were purchased from R and D Systems (688-TK-100). Information received from authors. Sortilin is of human origin and the aminoacid range of the extracellular domain used in the spr assay (Fig.1d) confirmed in PMID: 9927419 and by the author. All the proteins expressed in 293 cells are of human origin (confirmed by the authors) an@biokemi.au.dk, cv@biokemi.au.dk 12-Nov-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-brain_hippocampal_neuron Mus musculus, brain, hippocampal neurons brain-hippocampus_neuron Hippocampal neuron anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Vaegter C.B., Jansen P., Fjorback A.W., Glerup S., Skeldal S., Kjolby M., Richner M., Erdmann B., Nyengaard J.R., Tessarollo L., Lewin G.R., Willnow T.E., Chao M.V., Nykjaer A. Cardiac - Interactions involving cardiac related proteins The TrK ectodomains used in the spr assay (Fig. 1d) were purchased from R and D Systems (688-TK-100). Information received from authors. an@biokemi.au.dk, cv@biokemi.au.dk Accepted 2014-OCT-15 by ORCHARD Nat. Neurosci. (1097-6256) 2011 imex curation Sortilin associates with Trk receptors to enhance anterograde transport and neurotrophin signaling. Sortilin associates with Trk receptors to enhance anterograde transport and neurotrophin signaling. Nat. Neurosci. (1097-6256) 2011 imex curation Vaegter C.B., Jansen P., Fjorback A.W., Glerup S., Skeldal S., Kjolby M., Richner M., Erdmann B., Nyengaard J.R., Tessarollo L., Lewin G.R., Willnow T.E., Chao M.V., Nykjaer A. Cardiac - Interactions involving cardiac related proteins The TrK ectodomains used in the spr assay (Fig. 1d) were purchased from R and D Systems (688-TK-100). Information received from authors. Sortilin is of human origin and the aminoacid range of the extracellular domain used in the spr assay (Fig.1d) confirmed in PMID: 9927419 and by the author. All the proteins expressed in 293 cells are of human origin (confirmed by the authors) an@biokemi.au.dk, cv@biokemi.au.dk 12-Nov-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Vaegter C.B., Jansen P., Fjorback A.W., Glerup S., Skeldal S., Kjolby M., Richner M., Erdmann B., Nyengaard J.R., Tessarollo L., Lewin G.R., Willnow T.E., Chao M.V., Nykjaer A. Cardiac - Interactions involving cardiac related proteins The TrK ectodomains used in the spr assay (Fig. 1d) were purchased from R and D Systems (688-TK-100). Information received from authors. an@biokemi.au.dk, cv@biokemi.au.dk Accepted 2014-OCT-15 by ORCHARD Nat. Neurosci. (1097-6256) 2011 imex curation Sortilin associates with Trk receptors to enhance anterograde transport and neurotrophin signaling. Sortilin associates with Trk receptors to enhance anterograde transport and neurotrophin signaling. Nat. Neurosci. (1097-6256) 2011 imex curation Vaegter C.B., Jansen P., Fjorback A.W., Glerup S., Skeldal S., Kjolby M., Richner M., Erdmann B., Nyengaard J.R., Tessarollo L., Lewin G.R., Willnow T.E., Chao M.V., Nykjaer A. Cardiac - Interactions involving cardiac related proteins The TrK ectodomains used in the spr assay (Fig. 1d) were purchased from R and D Systems (688-TK-100). Information received from authors. Sortilin is of human origin and the aminoacid range of the extracellular domain used in the spr assay (Fig.1d) confirmed in PMID: 9927419 and by the author. All the proteins expressed in 293 cells are of human origin (confirmed by the authors) an@biokemi.au.dk, cv@biokemi.au.dk 12-Nov-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Vaegter C.B., Jansen P., Fjorback A.W., Glerup S., Skeldal S., Kjolby M., Richner M., Erdmann B., Nyengaard J.R., Tessarollo L., Lewin G.R., Willnow T.E., Chao M.V., Nykjaer A. Cardiac - Interactions involving cardiac related proteins All Trk proteins showed high affinity binding to sortilin, with estimated Kd values between 10 and 20 nM The TrK ectodomains used in the spr assay (Fig. 1d) were purchased from R and D Systems (688-TK-100). Information received from authors. an@biokemi.au.dk, cv@biokemi.au.dk Accepted 2014-OCT-15 by ORCHARD Nat. Neurosci. (1097-6256) 2011 imex curation Sortilin associates with Trk receptors to enhance anterograde transport and neurotrophin signaling. Sortilin associates with Trk receptors to enhance anterograde transport and neurotrophin signaling. Nat. Neurosci. (1097-6256) 2011 imex curation Vaegter C.B., Jansen P., Fjorback A.W., Glerup S., Skeldal S., Kjolby M., Richner M., Erdmann B., Nyengaard J.R., Tessarollo L., Lewin G.R., Willnow T.E., Chao M.V., Nykjaer A. Cardiac - Interactions involving cardiac related proteins The TrK ectodomains used in the spr assay (Fig. 1d) were purchased from R and D Systems (688-TK-100). Information received from authors. Sortilin is of human origin and the aminoacid range of the extracellular domain used in the spr assay (Fig.1d) confirmed in PMID: 9927419 and by the author. All the proteins expressed in 293 cells are of human origin (confirmed by the authors) an@biokemi.au.dk, cv@biokemi.au.dk 12-Nov-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-scg neuron mouse-superior cervical ganglion neuron mouse-scg neuron mouse-superior cervical ganglion neuron confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Vaegter C.B., Jansen P., Fjorback A.W., Glerup S., Skeldal S., Kjolby M., Richner M., Erdmann B., Nyengaard J.R., Tessarollo L., Lewin G.R., Willnow T.E., Chao M.V., Nykjaer A. Cardiac - Interactions involving cardiac related proteins The TrK ectodomains used in the spr assay (Fig. 1d) were purchased from R and D Systems (688-TK-100). Information received from authors. an@biokemi.au.dk, cv@biokemi.au.dk Accepted 2014-OCT-15 by ORCHARD Nat. Neurosci. (1097-6256) 2011 imex curation p04629-2 High affinity nerve growth factor receptor NTRK1 MTC Neurotrophic tyrosine kinase receptor type 1 TRK TRK1-transforming tyrosine kinase protein TRKA Tropomyosin-related kinase A Tyrosine kinase receptor Tyrosine kinase receptor A gp140trk p140-TrkA TrkAI protein protein human Homo sapiens Human MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPDTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG mint Has enhanced responsiveness to NTF3 neurotrophin. 25F05BADA8A2A50C ntrk1_mouse High affinity nerve growth factor receptor Ntrk1 Neurotrophic tyrosine kinase receptor type 1 protein protein mouse Mus musculus Mouse MLRGQRLGQLGWHRPAAGLGSLMTSLMLACASAASCREVCCPVGPSGLRCTRAGSLDTLRGLRGAGNLTELYVENQQHLQRLEFEDLQGLGELRSLTIVKSGLRFVAPDAFRFTPRLSHLNLSSNALESLSWKTVQGLSLQDLTLSGNPLHCSCALFWLQRWEQEGLCGVHTQTLHDSGPGDQFLPLGHNTSCGVPTVKIQMPNDSVEVGDDVFLQCQVEGLALQQADWILTELEGAATVKKFGDLPSLGLILVNVTSDLNKKNVTCWAENDVGRAEVSVQVSVSFPASVHLGLAVEQHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTQFLESALTNETMRHGCLRLNQPTHVNNGNYTLLAANPYGQAAASVMAAFMDNPFEFNPEDPIPVSFSPVDGNSTSRDPVEKKDETPFGVSVAVGLAVSAALFLSALLLVLNKCGQRSKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIMENPQYFSDTCVHHIKRQDIILKWELGEGAFGKVFLAECYNLLNDQDKMLVAVKALKEASENARQDFQREAELLTMLQHQHIVRFFGVCTEGGPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLASLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFSTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIECITQGRELERPRACPPDVYAIMRGCWQREPQQRLSMKDVHARLQALAQAPPSYLDVLG DIP protein Q3UFB7 original sequence version: 89 1A37F76A63564603 sort_human Sortilin SORT1 Neurotensin receptor 3 Glycoprotein 95 100 kDa NT receptor protein protein human Homo sapiens Human MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRRSAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE DIP protein Q99523 original sequence version: 97 DIP protein Q99523-1 original sequence version: 127 91F96A3035A4B43A sort_mouse Sortilin Sort1 Neurotensin receptor 3 protein protein mouse Mus musculus Mouse MERPRGAADGLLRWPLGLLLLLQLLPPAAVGQDRLDAPPPPAPPLLRWAGPVGVSWGLRAAAPGGPVPRAGRWRRGAPAEDQDCGRLPDFIAKLTNNTHQHVFDDLSGSVSLSWVGDSTGVILVLTTFQVPLVIVSFGQSKLYRSEDYGKNFKDITNLINNTFIRTEFGMAIGPENSGKVILTAEVSGGSRGGRVFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGEKWEEIHKAVCLAKWGPNNIIFFTTHVNGSCKADLGALELWRTSDLGKTFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANEDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSTLSEDNSIQSMITFDQGGRWEHLRKPENSKCDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWAKMLEGPHYYTILDSGGIIVAIEHSNRPINVIKFSTDEGQCWQSYVFTQEPIYFTGLASEPGARSMNISIWGFTESFITRQWVSYTVDFKDILERNCEEDDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSVCPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDKCQGGMNPAREVKDLKKKCTSNFLNPTKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEADGVEALDSTSHAKSGYHDDSDEDLLE DIP protein Q6PHU5 original sequence version: 45 DIP protein Q6PHU5 original sequence version: 62 Functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Required for protein transport from the Golgi apparatus to the lysosomes by a pathway that is independent of the mannose-6-phosphate receptor (M6PR). Also required for protein transport from the Golgi apparatus to the endosomes. Promotes neuronal apoptosis by mediating endocytosis of the proapoptotic precursor forms of BDNF (proBDNF) and NGFB (proNGFB). Also acts as a receptor for neurotensin. May promote mineralization of the extracellular matrix during osteogenic differentiation by scavenging extracellular LPL. Probably required in adipocytes for the formation of specialized storage vesicles containing the glucose transporter SLC2A4/GLUT4 (GLUT4 storage vesicles, or GSVs). These vesicles provide a stable pool of SLC2A4 and confer increased responsiveness to insulin. May also mediate transport from the endoplasmic reticulum to the Golgi mint 9A7A73C6FE1C8201 ntrk2_human BDNF/NT-3 growth factors receptor Tropomyosin-related kinase B NTRK2 TRKB GP145-TrkB Neurotrophic tyrosine kinase receptor type 2 TrkB tyrosine kinase protein protein human Homo sapiens Human MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG DIP protein Q16620 original sequence version: 83 DIP protein Q16620 original sequence version: 129 DIP protein Q16620 original sequence version: 151 2FEB9159948F0D13 ntrk2_mouse BDNF/NT-3 growth factors receptor Ntrk2 Trkb Neurotrophic tyrosine kinase receptor type 2 TrkB tyrosine kinase GP145-TrkB/GP95-TrkB protein protein mouse Mus musculus Mouse MSPWLKWHGPAMARLWGLCLLVLGFWRASLACPTSCKCSSARIWCTEPSPGIVAFPRLEPNSVDPENITEILIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAYKAFLKNSNLRHINFTRNKLTSLSRRHFRHLDLSDLILTGNPFTCSCDIMWLKTLQETKSSPDTQDLYCLNESSKNMPLANLQIPNCGLPSARLAAPNLTVEEGKSVTLSCSVGGDPLPTLYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHHWCIPFTVRGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLMAKNEYGKDERQISAHFMGRPGVDYETNPNYPEVLYEDWTTPTDIGDTTNKSNEIPSTDVADQSNREHLSVYAVVVIASVVGFCLLVMLLLLKLARHSKFGMKGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHTRKNIKSIHTLLQNLAKASPVYLDILG DIP protein P15209 original sequence version: 171 DIP protein P15209 original sequence version: 90 DIP protein P15209 original sequence version: 138 DIP protein P15209 original sequence version: 151 50E08D5FF86D8F30 ntrk1_human High affinity nerve growth factor receptor NTRK1 TRK Neurotrophic tyrosine kinase receptor type 1 TRK1-transforming tyrosine kinase protein p140-TrkA MTC TRKA Tropomyosin-related kinase A Tyrosine kinase receptor Tyrosine kinase receptor A gp140trk protein protein human Homo sapiens Human MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG DIP protein P04629 original sequence version: 203 DIP protein P04629 original sequence version: 192 6C15C721E336B601 ntrk3_human NT-3 growth factor receptor NTRK3 TRKC GP145-TrkC Neurotrophic tyrosine kinase receptor type 3 TrkC tyrosine kinase protein protein human Homo sapiens Human MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEAKLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALTVYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHVEYYQEGEISEGCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPITVTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASPLHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVLKRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYRLFNPSGNDFCIWCEVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVIECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG DIP protein Q16288 original sequence version: 169 7FE8846830083C08 ntrk3-sort1-1 3 8 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association Fig. 1B ntrk1-sort1-1 3 8 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Fig. 1B sort1-ntrk1 3 8 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Fig. 1B sort1-ntrk2 2 9 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association Fig 1E ntrk1-sort1-3 5 9 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 1F sort1-ntrk2-1 4 10 unspecified role unspecified role prey prey ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-teminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role bait bait extracellular domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 31 35 direct interaction direct interaction Fg. 1D sort1-ntrk1-2 4 6 unspecified role unspecified role prey prey ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-teminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role bait bait extracellular domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 38 41 direct interaction direct interaction Fg. 1D sort1-ntrk2-2 4 13 unspecified role unspecified role prey prey ectodomain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-teminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role bait bait extracellular domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 48 44 direct interaction direct interaction Fg. 1D ntrk1-sort1-5 1 12 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept 8 unspecified role unspecified role fluorescence donor fluorescence donor colocalization colocalization Fig. 1C