bhf-ucl The Hippo pathway regulates Wnt/beta-catenin signaling. The Hippo pathway regulates Wnt/beta-catenin signaling. Dev. Cell (1534-5807) 2010 imex curation Varelas X., Miller B.W., Sopko R., Song S., Gregorieff A., Fellouse F.A., Sakuma R., Pawson T., Hunziker W., McNeill H., Wrana J.L., Attisano L. Cardiac - Interactions involving cardiac related proteins liliana.attisano@utoronto.ca 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. lumier luminescence based mammalian interactome mapping lumier tag luciferase tag visualisation by luciferase assay tag luciferase Varelas X., Miller B.W., Sopko R., Song S., Gregorieff A., Fellouse F.A., Sakuma R., Pawson T., Hunziker W., McNeill H., Wrana J.L., Attisano L. Cardiac - Interactions involving cardiac related proteins I did not annotate interactions between TAZ and beta-TRCP, shown in Figure S3, as the species of beta-TRCP is unknown. liliana.attisano@utoronto.ca Accepted 2014-FEB-24 by PPORRAS Dev. Cell (1534-5807) 2010 imex curation The Hippo pathway regulates Wnt/beta-catenin signaling. The Hippo pathway regulates Wnt/beta-catenin signaling. Dev. Cell (1534-5807) 2010 imex curation Varelas X., Miller B.W., Sopko R., Song S., Gregorieff A., Fellouse F.A., Sakuma R., Pawson T., Hunziker W., McNeill H., Wrana J.L., Attisano L. Cardiac - Interactions involving cardiac related proteins liliana.attisano@utoronto.ca 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Varelas X., Miller B.W., Sopko R., Song S., Gregorieff A., Fellouse F.A., Sakuma R., Pawson T., Hunziker W., McNeill H., Wrana J.L., Attisano L. Cardiac - Interactions involving cardiac related proteins liliana.attisano@utoronto.ca Accepted 2014-FEB-24 by PPORRAS Dev. Cell (1534-5807) 2010 imex curation The Hippo pathway regulates Wnt/beta-catenin signaling. The Hippo pathway regulates Wnt/beta-catenin signaling. Dev. Cell (1534-5807) 2010 imex curation Varelas X., Miller B.W., Sopko R., Song S., Gregorieff A., Fellouse F.A., Sakuma R., Pawson T., Hunziker W., McNeill H., Wrana J.L., Attisano L. Cardiac - Interactions involving cardiac related proteins liliana.attisano@utoronto.ca 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Varelas X., Miller B.W., Sopko R., Song S., Gregorieff A., Fellouse F.A., Sakuma R., Pawson T., Hunziker W., McNeill H., Wrana J.L., Attisano L. Cardiac - Interactions involving cardiac related proteins liliana.attisano@utoronto.ca Accepted 2014-FEB-24 by PPORRAS Dev. Cell (1534-5807) 2010 imex curation The Hippo pathway regulates Wnt/beta-catenin signaling. The Hippo pathway regulates Wnt/beta-catenin signaling. Dev. Cell (1534-5807) 2010 imex curation Varelas X., Miller B.W., Sopko R., Song S., Gregorieff A., Fellouse F.A., Sakuma R., Pawson T., Hunziker W., McNeill H., Wrana J.L., Attisano L. Cardiac - Interactions involving cardiac related proteins liliana.attisano@utoronto.ca 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. lumier luminescence based mammalian interactome mapping lumier tag luciferase tag visualisation by luciferase assay tag luciferase Varelas X., Miller B.W., Sopko R., Song S., Gregorieff A., Fellouse F.A., Sakuma R., Pawson T., Hunziker W., McNeill H., Wrana J.L., Attisano L. Cardiac - Interactions involving cardiac related proteins An anti-bait antibody was used for the IP instead of the usual anti-flag. liliana.attisano@utoronto.ca Accepted 2014-FEB-24 by PPORRAS Dev. Cell (1534-5807) 2010 imex curation The Hippo pathway regulates Wnt/beta-catenin signaling. The Hippo pathway regulates Wnt/beta-catenin signaling. Dev. Cell (1534-5807) 2010 imex curation Varelas X., Miller B.W., Sopko R., Song S., Gregorieff A., Fellouse F.A., Sakuma R., Pawson T., Hunziker W., McNeill H., Wrana J.L., Attisano L. Cardiac - Interactions involving cardiac related proteins liliana.attisano@utoronto.ca 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Varelas X., Miller B.W., Sopko R., Song S., Gregorieff A., Fellouse F.A., Sakuma R., Pawson T., Hunziker W., McNeill H., Wrana J.L., Attisano L. Cardiac - Interactions involving cardiac related proteins liliana.attisano@utoronto.ca Accepted 2014-FEB-24 by PPORRAS Dev. Cell (1534-5807) 2010 imex curation dvl2_human Segment polarity protein dishevelled homolog DVL-2 DSH homolog 2 DVL2 protein protein human Homo sapiens Human MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPLPPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRERPRRRDSSEHGAGGHRTGGPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQSSASRLLKRHRRRRKQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSVHTDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLPGATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGGAGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEASGTSDGGPPPSRGSTGGAPNLRAHPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQSFHMAMGNPSEFFVDVM DIP protein O14641 original sequence version: 150 DIP protein O14641 original sequence version: 113 DIP protein O14641 original sequence version: 124 DIP protein O14641 original sequence version: 154 DIP protein O14641 original sequence version: 159 4BAD95B6C3FE531B wwtr1_human WW domain-containing transcription regulator protein 1 Transcriptional coactivator with PDZ-binding motif WWTR1 TAZ protein protein human Homo sapiens Human MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNNSSDPFLNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL 630B50F46FB74C60 lats1_human Serine/threonine-protein kinase LATS1 Large tumor suppressor homolog 1 WARTS protein kinase LATS1 WARTS protein protein human Homo sapiens Human MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEDMVIQALQKTNNRSIEAAIEFISKMSYQDPRREQMAAAAARPINASMKPGNVQQSVNRKQSWKGSKESLVPQRHGPPLGESVAYHSESPNSQTDVGRPLSGSGISAFVQAHPSNGQRVNPPPPPQVRSVTPPPPPRGQTPPPRGTTPPPPSWEPNSQTKRYSGNMEYVISRISPVPPGAWQEGYPPPPLNTSPMNPPNQGQRGISSVPVGRQPIIMQSSSKFNFPSGRPGMQNGTGQTDFMIHQNVVPAGTVNRQPPPPYPLTAANGQSPSALQTGGSAAPSSYTNGSIPQSMMVPNRNSHNMELYNISVPGLQTNWPQSSSAPAQSSPSSGHEIPTWQPNIPVRSNSFNNPLGNRASHSANSQPSATTVTAITPAPIQQPVKSMRVLKPELQTALAPTHPSWIPQPIQTVQPSPFPEGTASNVTVMPPVAEAPNYQGPPPPYPKHLLHQNPSVPPYESISKPSKEDQPSLPKEDESEKSYENVDSGDKEKKQITTSPITVRKNKKDEERRESRIQSYSPQAFKFFMEQHVENVLKSHQQRLHRKKQLENEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAKMDKSMFVKIKTLGIGAFGEVCLARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSSCRCGDRLKPLERRAARQHQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQMKVINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLRQQSASYIPKITHPTDTSNFDPVDPDKLWSDDNEEENVNDTLNGWYKNGKHPEHAFYEFTFRRFFDDNGYPYNYPKPIEYEYINSQGSEQQSDEDDQNTGSEIKNRDLVYV DIP protein O95835 original sequence version: 133 DIP protein O95835 original sequence version: 147 DIP protein O95835 original sequence version: 144 DIP protein O95835 original sequence version: 142 DIP protein O95835-1 original sequence version: 142 11CFBCD8FD87DCD8 dsh_drome Segment polarity protein dishevelled dsh CG18361 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDADRGGGQETKVIYHIDDETTPYLVKIPIPSAQVTLRDFKLVLNKQNNNYKYFFKSMDADFGVVKEEIADDSTILPCFNGRVVSWLVSADGTNQSDNCSELPTSECELGMGLTNRKLQQQQQQHQQQQQQQQQQHQQQQQQQQQQVQPVQLAQQQQQQVLHHQKMMGNPLLQPPPLTYQSASVLSSDLDSTSLFGTESELTLDRDMTDYSSVQRLQVRKKPQRRKKRAPSMSRTSSYSSITDSTMSLNIITVSINMEAVNFLGISIVGQSNRGGDGGIYVGSIMKGGAVALDGRIEPGDMILQVNDVNFENMTNDEAVRVLREVVQKPGPIKLVVAKCWDPNPKGYFTIPRTEPVRPIDPGAWVAHTQALTSHDSIIADIAEPIKERLDQNNLEEIVKAMTKPDSGLEIRDRMWLKITIPNAFIGADAVNWVLENVEDVQDRREARRIVSAMLRSNYIKHTVNKLTFSEQCYYVVNEERNPNLLGRGHLHPHQLPHGHGGHALSHADTESITSDIGPLPNPPIYMPYSATYNPSHGYQPIQYGIAERHISSGSSSSDVLTSKDISASQSDITSVIHQANQLTIAAHGSNKSSGSSNRGGGGGGGGGGNNTNDQDVSVFNYVL 0BA24ED350666CF5 dvl1_human Segment polarity protein dishevelled homolog DVL-1 DVL1 DSH homolog 1 protein protein human Homo sapiens Human MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSFHPNVASSRDGMDNETGTESMVSHRRERARRRNREEAARTNGHPRGDRRRDVGLPPDSASTALSSELESSSFVDSDEDGSTSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQADRASSFSSITDSTMSLNIVTVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTVPRADPVRPIDPAAWLSHTAALTGALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNKITFSEQCYYVFGDLCSNLATLNLNSGSSGTSDQDTLAPLPHPAAPWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM DIP protein O14640 original sequence version: 114 B009BDBCC57BD562 dvl3_human Segment polarity protein dishevelled homolog DVL-3 DVL3 KIAA0208 DSH homolog 3 protein protein human Homo sapiens Human MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELPPPMERTGGIGDSRPPSFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTAKGERRREPGGYDSSSTLMSSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAAWVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHTVNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQYPPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGGSGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLASSLRSHHTHPSYGPPGVPPLYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM DIP protein Q92997 original sequence version: 110 B1A55EBF9507D06E yap1_drome Transcriptional coactivator yorkie yki Protein yorkie Transcriptional coactivator YAP1 homolog CG4005 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MLTTMSASSNTNSLIEKEIDDEDMLSPIKSNNLVVRVNQDTDDNLQALFDSVLNPGDAKRPLQLPLRMRKLPNSFFTPPAPSHSRANSADSTYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHSRLAIHHSRARSSPASLQQNYNVRARSDAAAANNPNANPSSQQQPAGPTFPENSAQEFPSGAPASSAIDLDAMNTCMSQDIPMSMQTVHKKQRSYDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIANNLGPLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQSGLSVLDCPDNLVSSLQIEDNLCSNLFNDAQAIVNPPSSHKPDDLEWYKIN 0F04A0C73D52C507 q5r2u3_human CK1E protein protein human Homo sapiens Human TNVPFDHLGK D18E7321EAA9D772 taz_human Tafazzin TAFAZZIN EFE2 G4.5 Protein G4.5 TAZ protein protein human Homo sapiens Human MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTKYMNHLTVHNREVLYELIEKRGPATPLITVSNHQSCMDDPHLWGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGAEFFQAENEGKGVLDTGRHMPGAGKRREKGDGVYQKGMDFILEKLNHGDWVHIFPEGKVNMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR 2805E0962DC4FE52 dvl1-taz 2 7 unspecified role unspecified role prey prey nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role bait bait nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 3A taz-dvl2-2 3 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Fig. 3B dvl3-taz-1 2 7 unspecified role unspecified role prey prey nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role bait bait nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 3A taz-dvl2 1 6 unspecified role unspecified role prey prey nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus firefly luciferase protein tag firefly luciferase protein tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range pdz and ww domains required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain The interaction between TAZ and Dvl2 is not abolished, but reduced by ~ 75% in the absence of the two domains. physical association physical association Fig. 3C taz-dvl2-1 2 7 unspecified role unspecified role bait bait nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role prey prey nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Following strictly the rules I should have put the Delta DZDeltaPY construct as sufficient to bind, but this would contradict the message the authors want to convey that the PDZ and PY domains are important. Is this O.K.? These two regions contain the PDZ domain and a PY motif respectively. physical association physical association Fig. 3A, D dvl2-ck1e 2 6 unspecified role unspecified role bait bait nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 4D human Flag-TAZ dvl2-ck1e-1 4 13 unspecified role unspecified role prey prey nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus luciferase tag luciferase tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role bait bait physical association physical association Fig. 4E human 3Flag-TAZ containing DVL2-binding region. taz-lats1 3 7 unspecified role unspecified role bait bait cell lysate cell lysate 8 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association Fig 5A dvl2-taz-2 5 6 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 6B human LATS1 dvl1-wwtr1 1 10 unspecified role unspecified role bait bait nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus firefly luciferase protein tag firefly luciferase protein tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role prey prey nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range pdz domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association S1B dvl2-wwtr1 1 6 unspecified role unspecified role bait bait nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus firefly luciferase protein tag firefly luciferase protein tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role prey prey nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range pdz domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. S1B wwtr1-dvl2 1 12 unspecified role unspecified role prey prey nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus firefly luciferase protein tag firefly luciferase protein tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role bait bait nucl lipotransfect nucleic acid transfection with liposome nucl lipotransfect n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range pdz and py motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain The interaction is not completely abolished, but ~ 75% reduced when both elements are missing. physical association physical association Fig. S7