IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction of connexin43 and protein kinase C-delta during FGF2 signaling. Interaction of connexin43 and protein kinase C-delta during FGF2 signaling. BMC biochemistry 2009 imex curation Niger C., Hebert C., Stains JP. Cardiac - Interactions involving cardiac related proteins jstai002@umaryland.edu Only protein-protein interactions imex curation mouse-mc3t3-e1 Mus musculus mc3t3-e1 mc3t3-e1 fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Niger C., Hebert C., Stains JP. Cardiac - Interactions involving cardiac related proteins jstai002@umaryland.edu Accepted 2015-MAY-15 by ORCHARD BMC biochemistry 2009 imex curation Interaction of connexin43 and protein kinase C-delta during FGF2 signaling. Interaction of connexin43 and protein kinase C-delta during FGF2 signaling. BMC biochemistry 2009 imex curation Niger C., Hebert C., Stains JP. Cardiac - Interactions involving cardiac related proteins jstai002@umaryland.edu Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Niger C., Hebert C., Stains JP. Cardiac - Interactions involving cardiac related proteins GST-Cx43 has been assumed to be of Murine origin as the method section states:-"the C-terminal tail of the Cx43 protein (amino acids 241-382) were PCR amplified with the following forward and reverse primers: mCx43-EcoR1-241-Forward, GGAATTCCGTCTTCTTCAAGGGCGTT and mCx43-XhoI-382-Reverse, CCGCTCGAGTTAAATCTCCAGGTCAGG.". However a Blat of these sequences gives no results, and the quoted reference (61) does not mention the GST-Cx43 construct. jstai002@umaryland.edu Accepted 2015-MAY-05 by ORCHARD BMC biochemistry 2009 imex curation Interaction of connexin43 and protein kinase C-delta during FGF2 signaling. Interaction of connexin43 and protein kinase C-delta during FGF2 signaling. BMC biochemistry 2009 imex curation Niger C., Hebert C., Stains JP. Cardiac - Interactions involving cardiac related proteins jstai002@umaryland.edu Only protein-protein interactions imex curation mouse-mc3t3-e1 Mus musculus mc3t3-e1 mc3t3-e1 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Niger C., Hebert C., Stains JP. Cardiac - Interactions involving cardiac related proteins jstai002@umaryland.edu Accepted 2015-MAY-15 by ORCHARD BMC biochemistry 2009 Only protein-protein interactions imex curation imex curation I could not find an equivalent GO term for "punctate clusters near cell-cell contacts" -so I have just added "cell-cell contacts" which I am not sure is appropriate.; done kpcd_mouse Protein kinase C delta type nPKC-delta Tyrosine-protein kinase PRKCD Prkcd Pkcd protein protein mouse Mus musculus Mouse MAPFLRISFNSYELGSLQVEDEASQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKTTFDAHIYEGRVIQIVLMRAAEDPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMCVQYFLEDGDCKQSMRSEEEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRSSRKLDTTESVGIYQGFEKKPEVSGSDILDNNGTYGKIWEGSTRCTLENFTFQKVLGKGSFGKVLLAELKGKDKYFAIKCLKKDVVLIDDDVECTMVEKRVLALAWESPFLTHLICTFQTKDHLFFVMEFLNGGDLMFHIQDKGRFELYRATFYAAEIICGLQFLHSKGIIYRDLKLDNVMLDRDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDIMEKLFERDPDKRLGVTGNIRIHPFFKTINWSLLEKRKVEPPFKPKVKSPSDYSNFDPEFLNEKPQLSFSDKNLIDSMDQEAFHGFSFVNPKFEQFLDI DIP protein P28867 original sequence version: 135 6E9F753348F03D59 cxa1_mouse Gap junction alpha-1 protein Gja1 Cxn-43 Connexin-43 Gap junction 43 kDa heart protein protein protein mouse Mus musculus Mouse MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGCENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSLSAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVKGRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDSQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI DIP protein P23242 original sequence version: 72 DIP protein P23242 original sequence version: 132 DIP protein P23242 original sequence version: 153 018DCB461FA69490 kpce_mouse Protein kinase C epsilon type Prkce Pkce Pkcea nPKC-epsilon protein protein mouse Mus musculus Mouse MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTNSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLEPEGKVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDEVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIAKVLADLGVTPDKITNSGQRRKKLAAGAESPQPASGNSPSEDDRSKSAPTSPCDQELKELENNIRKALSFDNRGEEHRASSATDGQLASPGENGEVRPGQAKRLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGIMNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVAAQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPILTLVDEAIIKQINQEEFKGFSYFGEDLMP DIP protein P16054 original sequence version: 110 7AEBB8CC10C99F57 47ey-1 1 4 unspecified role unspecified role neutral component neutral component required_phosphothr505 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm 5 unspecified role unspecified role neutral component neutral component colocalization colocalization 3 gja1-prkcd-1 3 4 unspecified role unspecified role bait bait phosphothr505 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm 5 unspecified role unspecified role prey prey possible_phospho_ser opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined observed-ptm observed-ptm observed ptm observed-ptm physical association physical association 4C/D,5 There is a temporary increase in Cx43/PKCdelta association after 10 minutes of exposure to FGF2. prkcd-gja1-1 3 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 4B prkcd-gja1-2 3 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 4C-2 gja1-prkcd-3 2 4 unspecified role unspecified role prey prey mouse-mc3t3-e1 Mus musculus mc3t3-e1 mc3t3-e1 5 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 6