bhf-ucl Chylomicronemia with low postheparin lipoprotein lipase levels in the setting of GPIHBP1 defects. Chylomicronemia with low postheparin lipoprotein lipase levels in the setting of GPIHBP1 defects. Circ Cardiovasc Genet (1942-325X) 2010 imex curation Franssen R., Young S.G., Peelman F., Hertecant J., Sierts J.A., Schimmel A.W., Bensadoun A., Kastelein J.J., Fong L.G., Dallinga-Thie G.M., Beigneux A.P. Cardiac - Interactions involving cardiac related proteins CHO pgsA-745 cells were electroporated with empty vector or an expression vector for the wild type human GPIHBP1 (S tagged) or the corresponding mutant version. The cells were incubated with human LPL (V5 tagged) with or without heparin. After the incubation the cells were washed and the extracts were prepare for Western blotting. abeigneux@mednet.ucla.edu, g.m.dallinga@amc.nl 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro affinity techniques affinity technology affinity techniques anti tag western anti tag western blot anti tag western Franssen R., Young S.G., Peelman F., Hertecant J., Sierts J.A., Schimmel A.W., Bensadoun A., Kastelein J.J., Fong L.G., Dallinga-Thie G.M., Beigneux A.P. Cardiac - Interactions involving cardiac related proteins CHO pgsA-745 cells were electroporated with empty vector or an expression vector for the wild type human GPIHBP1 (S tagged) or the corresponding mutant version. The cells were incubated with human LPL (V5 tagged) with or without heparin. After the incubation the cells were washed and the extracts were prepare for Western blotting. abeigneux@mednet.ucla.edu, g.m.dallinga@amc.nl Accepted 2014-JAN-28 by ORCHARD Circ Cardiovasc Genet (1942-325X) 2010 imex curation lipl_human Lipoprotein lipase LPL LIPD Phospholipase A1 protein protein human Homo sapiens Human MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG FBD00FCD334FB8AA hdbp1_human Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 GPIHBP1 HBP1 High density lipoprotein-binding protein 1 protein protein human Homo sapiens Human MKALGAVLLALLLCGRPGRGQTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPTGKGAGGPRGSSETVGAALLLNLLAGLGAMGARRP 89FF61B08A008C70 gpihbp1-lpl-2 1 3 unspecified role unspecified role bait bait Q8IV16:p.Cys65Tyr mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C Y Wed May 02 19:59:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys65tyr' Tue Jun 30 18:16:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys65Tyr' Q8IV16:p.Gln115Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain Q P Wed May 02 16:08:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln115pro' Tue Jun 30 18:40:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln115Pro' s protein tag s tag s tag full dna sequence full identification by DNA sequencing full dna sequence undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 2 unspecified role unspecified role prey prey v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag full dna sequence full identification by DNA sequencing full dna sequence undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig.5 Heparin (CHEBI:28304)