bhf-ucl RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway. RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway. Mol. Cell (1097-2765) 2009 imex curation Miyake Y., Nakamura M., Nabetani A., Shimamura S., Tamura M., Yonehara S., Saito M., Ishikawa F. Cardiac - Interactions involving cardiac related proteins Dear Sandra, I am sorry. Yes, you are right. The telomeric DNA should be double-stranded in this case. So yes please, is it possible to add the other strand (TTAGGG)4 at the level of the database (I am guessing from your suggestion that I can't do it). However, telomeric DNA contains both double and single-stranded parts. The same repeat (TTAGGG)n is found in both but at the 3' end there is about 150 nt that are single stranded and form "blunt" ends. These proteins bind to the double-stranded bit even though the ChIP can only "see" what it is hybridizing to i.e. one strand of the DNA to which the protein was originally bound. Thanks Sandra Nancy fishikaw@lif.kyoto-u.ac.jp 28-Oct_2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Miyake Y., Nakamura M., Nabetani A., Shimamura S., Tamura M., Yonehara S., Saito M., Ishikawa F. Cardiac - Interactions involving cardiac related proteins Dear Sandra, I am sorry. Yes, you are right. The telomeric DNA should be double-stranded in this case. So yes please, is it possible to add the other strand (TTAGGG)4 at the level of the database (I am guessing from your suggestion that I can't do it). However, telomeric DNA contains both double and single-stranded parts. The same repeat (TTAGGG)n is found in both but at the 3' end there is about 150 nt that are single stranded and form "blunt" ends. These proteins bind to the double-stranded bit even though the ChIP can only "see" what it is hybridizing to i.e. one strand of the DNA to which the protein was originally bound. Thanks Sandra Nancy fishikaw@lif.kyoto-u.ac.jp Accepted 2013-OCT-21 by ORCHARD 28-Oct_2013: Contacted by IntAct-Help. Mol. Cell (1097-2765) 2009 imex curation RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway. RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway. Mol. Cell (1097-2765) 2009 imex curation Miyake Y., Nakamura M., Nabetani A., Shimamura S., Tamura M., Yonehara S., Saito M., Ishikawa F. Cardiac - Interactions involving cardiac related proteins Dear Sandra, I am sorry. Yes, you are right. The telomeric DNA should be double-stranded in this case. So yes please, is it possible to add the other strand (TTAGGG)4 at the level of the database (I am guessing from your suggestion that I can't do it). However, telomeric DNA contains both double and single-stranded parts. The same repeat (TTAGGG)n is found in both but at the 3' end there is about 150 nt that are single stranded and form "blunt" ends. These proteins bind to the double-stranded bit even though the ChIP can only "see" what it is hybridizing to i.e. one strand of the DNA to which the protein was originally bound. Thanks Sandra Nancy fishikaw@lif.kyoto-u.ac.jp 28-Oct_2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Miyake Y., Nakamura M., Nabetani A., Shimamura S., Tamura M., Yonehara S., Saito M., Ishikawa F. Cardiac - Interactions involving cardiac related proteins Dear Sandra, I am sorry. Yes, you are right. The telomeric DNA should be double-stranded in this case. So yes please, is it possible to add the other strand (TTAGGG)4 at the level of the database (I am guessing from your suggestion that I can't do it). However, telomeric DNA contains both double and single-stranded parts. The same repeat (TTAGGG)n is found in both but at the 3' end there is about 150 nt that are single stranded and form "blunt" ends. These proteins bind to the double-stranded bit even though the ChIP can only "see" what it is hybridizing to i.e. one strand of the DNA to which the protein was originally bound. Thanks Sandra Nancy fishikaw@lif.kyoto-u.ac.jp Accepted 2013-OCT-21 by ORCHARD 28-Oct_2013: Contacted by IntAct-Help. Mol. Cell (1097-2765) 2009 imex curation RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway. RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway. Mol. Cell (1097-2765) 2009 imex curation Miyake Y., Nakamura M., Nabetani A., Shimamura S., Tamura M., Yonehara S., Saito M., Ishikawa F. Cardiac - Interactions involving cardiac related proteins Dear Sandra, I am sorry. Yes, you are right. The telomeric DNA should be double-stranded in this case. So yes please, is it possible to add the other strand (TTAGGG)4 at the level of the database (I am guessing from your suggestion that I can't do it). However, telomeric DNA contains both double and single-stranded parts. The same repeat (TTAGGG)n is found in both but at the 3' end there is about 150 nt that are single stranded and form "blunt" ends. These proteins bind to the double-stranded bit even though the ChIP can only "see" what it is hybridizing to i.e. one strand of the DNA to which the protein was originally bound. Thanks Sandra Nancy fishikaw@lif.kyoto-u.ac.jp 28-Oct_2013: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column anti tag western anti tag western blot anti tag western Miyake Y., Nakamura M., Nabetani A., Shimamura S., Tamura M., Yonehara S., Saito M., Ishikawa F. Cardiac - Interactions involving cardiac related proteins Dear Sandra, I am sorry. Yes, you are right. The telomeric DNA should be double-stranded in this case. So yes please, is it possible to add the other strand (TTAGGG)4 at the level of the database (I am guessing from your suggestion that I can't do it). However, telomeric DNA contains both double and single-stranded parts. The same repeat (TTAGGG)n is found in both but at the 3' end there is about 150 nt that are single stranded and form "blunt" ends. These proteins bind to the double-stranded bit even though the ChIP can only "see" what it is hybridizing to i.e. one strand of the DNA to which the protein was originally bound. Thanks Sandra Nancy The proteins were first purified as a complex by anti-tag coip. fishikaw@lif.kyoto-u.ac.jp Accepted 2013-OCT-21 by ORCHARD 28-Oct_2013: Contacted by IntAct-Help. Mol. Cell (1097-2765) 2009 imex curation RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway. RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway. Mol. Cell (1097-2765) 2009 imex curation Miyake Y., Nakamura M., Nabetani A., Shimamura S., Tamura M., Yonehara S., Saito M., Ishikawa F. Cardiac - Interactions involving cardiac related proteins Dear Sandra, I am sorry. Yes, you are right. The telomeric DNA should be double-stranded in this case. So yes please, is it possible to add the other strand (TTAGGG)4 at the level of the database (I am guessing from your suggestion that I can't do it). However, telomeric DNA contains both double and single-stranded parts. The same repeat (TTAGGG)n is found in both but at the 3' end there is about 150 nt that are single stranded and form "blunt" ends. These proteins bind to the double-stranded bit even though the ChIP can only "see" what it is hybridizing to i.e. one strand of the DNA to which the protein was originally bound. Thanks Sandra Nancy fishikaw@lif.kyoto-u.ac.jp 28-Oct_2013: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Miyake Y., Nakamura M., Nabetani A., Shimamura S., Tamura M., Yonehara S., Saito M., Ishikawa F. Cardiac - Interactions involving cardiac related proteins Author states that the amount of telomeric DNAs that immunoprecipitated with anti-hCtc1, anti-hStn1, and anti-hTen1 antibodies was not varied significantly during cell-cycle progression after double-thymidine block and release (Figure 3K), consistent with the result of hStn1- telomere association revealed by IF measurements (Figure 1D). Author also states that We found that Ctc1 and Stn1 associated with telomeric DNA in Pot1-knockdown cells to an extent comparable to mock cells in ChIP experiments (Figure 6B). Dear Sandra, I am sorry. Yes, you are right. The telomeric DNA should be double-stranded in this case. So yes please, is it possible to add the other strand (TTAGGG)4 at the level of the database (I am guessing from your suggestion that I can't do it). However, telomeric DNA contains both double and single-stranded parts. The same repeat (TTAGGG)n is found in both but at the 3' end there is about 150 nt that are single stranded and form "blunt" ends. These proteins bind to the double-stranded bit even though the ChIP can only "see" what it is hybridizing to i.e. one strand of the DNA to which the protein was originally bound. Thanks Sandra Nancy fishikaw@lif.kyoto-u.ac.jp Accepted 2013-OCT-21 by ORCHARD 28-Oct_2013: Contacted by IntAct-Help. Mol. Cell (1097-2765) 2009 imex curation RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway. RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway. Mol. Cell (1097-2765) 2009 imex curation Miyake Y., Nakamura M., Nabetani A., Shimamura S., Tamura M., Yonehara S., Saito M., Ishikawa F. Cardiac - Interactions involving cardiac related proteins Dear Sandra, I am sorry. Yes, you are right. The telomeric DNA should be double-stranded in this case. So yes please, is it possible to add the other strand (TTAGGG)4 at the level of the database (I am guessing from your suggestion that I can't do it). However, telomeric DNA contains both double and single-stranded parts. The same repeat (TTAGGG)n is found in both but at the 3' end there is about 150 nt that are single stranded and form "blunt" ends. These proteins bind to the double-stranded bit even though the ChIP can only "see" what it is hybridizing to i.e. one strand of the DNA to which the protein was originally bound. Thanks Sandra Nancy fishikaw@lif.kyoto-u.ac.jp 28-Oct_2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells tap tandem affinity purification TAP TAP tap sequence tag sequence tag identification sequence tag Miyake Y., Nakamura M., Nabetani A., Shimamura S., Tamura M., Yonehara S., Saito M., Ishikawa F. Cardiac - Interactions involving cardiac related proteins Dear Sandra, I am sorry. Yes, you are right. The telomeric DNA should be double-stranded in this case. So yes please, is it possible to add the other strand (TTAGGG)4 at the level of the database (I am guessing from your suggestion that I can't do it). However, telomeric DNA contains both double and single-stranded parts. The same repeat (TTAGGG)n is found in both but at the 3' end there is about 150 nt that are single stranded and form "blunt" ends. These proteins bind to the double-stranded bit even though the ChIP can only "see" what it is hybridizing to i.e. one strand of the DNA to which the protein was originally bound. Thanks Sandra Nancy fishikaw@lif.kyoto-u.ac.jp Accepted 2013-OCT-21 by ORCHARD 28-Oct_2013: Contacted by IntAct-Help. Mol. Cell (1097-2765) 2009 imex curation RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway. RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway. Mol. Cell (1097-2765) 2009 imex curation Miyake Y., Nakamura M., Nabetani A., Shimamura S., Tamura M., Yonehara S., Saito M., Ishikawa F. Cardiac - Interactions involving cardiac related proteins Dear Sandra, I am sorry. Yes, you are right. The telomeric DNA should be double-stranded in this case. So yes please, is it possible to add the other strand (TTAGGG)4 at the level of the database (I am guessing from your suggestion that I can't do it). However, telomeric DNA contains both double and single-stranded parts. The same repeat (TTAGGG)n is found in both but at the 3' end there is about 150 nt that are single stranded and form "blunt" ends. These proteins bind to the double-stranded bit even though the ChIP can only "see" what it is hybridizing to i.e. one strand of the DNA to which the protein was originally bound. Thanks Sandra Nancy fishikaw@lif.kyoto-u.ac.jp 28-Oct_2013: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging anti-tag immunocytochemistry anti-tag immunocytochemistry Miyake Y., Nakamura M., Nabetani A., Shimamura S., Tamura M., Yonehara S., Saito M., Ishikawa F. Cardiac - Interactions involving cardiac related proteins Dear Sandra, I am sorry. Yes, you are right. The telomeric DNA should be double-stranded in this case. So yes please, is it possible to add the other strand (TTAGGG)4 at the level of the database (I am guessing from your suggestion that I can't do it). However, telomeric DNA contains both double and single-stranded parts. The same repeat (TTAGGG)n is found in both but at the 3' end there is about 150 nt that are single stranded and form "blunt" ends. These proteins bind to the double-stranded bit even though the ChIP can only "see" what it is hybridizing to i.e. one strand of the DNA to which the protein was originally bound. Thanks Sandra Nancy fishikaw@lif.kyoto-u.ac.jp Accepted 2013-OCT-21 by ORCHARD 28-Oct_2013: Contacted by IntAct-Help. Mol. Cell (1097-2765) 2009 imex curation RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway. RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway. Mol. Cell (1097-2765) 2009 imex curation Miyake Y., Nakamura M., Nabetani A., Shimamura S., Tamura M., Yonehara S., Saito M., Ishikawa F. Cardiac - Interactions involving cardiac related proteins Dear Sandra, I am sorry. Yes, you are right. The telomeric DNA should be double-stranded in this case. So yes please, is it possible to add the other strand (TTAGGG)4 at the level of the database (I am guessing from your suggestion that I can't do it). However, telomeric DNA contains both double and single-stranded parts. The same repeat (TTAGGG)n is found in both but at the 3' end there is about 150 nt that are single stranded and form "blunt" ends. These proteins bind to the double-stranded bit even though the ChIP can only "see" what it is hybridizing to i.e. one strand of the DNA to which the protein was originally bound. Thanks Sandra Nancy fishikaw@lif.kyoto-u.ac.jp 28-Oct_2013: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Miyake Y., Nakamura M., Nabetani A., Shimamura S., Tamura M., Yonehara S., Saito M., Ishikawa F. Cardiac - Interactions involving cardiac related proteins Dear Sandra, I am sorry. Yes, you are right. The telomeric DNA should be double-stranded in this case. So yes please, is it possible to add the other strand (TTAGGG)4 at the level of the database (I am guessing from your suggestion that I can't do it). However, telomeric DNA contains both double and single-stranded parts. The same repeat (TTAGGG)n is found in both but at the 3' end there is about 150 nt that are single stranded and form "blunt" ends. These proteins bind to the double-stranded bit even though the ChIP can only "see" what it is hybridizing to i.e. one strand of the DNA to which the protein was originally bound. Thanks Sandra Nancy fishikaw@lif.kyoto-u.ac.jp Accepted 2013-OCT-21 by ORCHARD 28-Oct_2013: Contacted by IntAct-Help. Mol. Cell (1097-2765) 2009 imex curation RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway. RPA-like mammalian Ctc1-Stn1-Ten1 complex binds to single-stranded DNA and protects telomeres independently of the Pot1 pathway. Mol. Cell (1097-2765) 2009 imex curation Miyake Y., Nakamura M., Nabetani A., Shimamura S., Tamura M., Yonehara S., Saito M., Ishikawa F. Cardiac - Interactions involving cardiac related proteins Dear Sandra, I am sorry. Yes, you are right. The telomeric DNA should be double-stranded in this case. So yes please, is it possible to add the other strand (TTAGGG)4 at the level of the database (I am guessing from your suggestion that I can't do it). However, telomeric DNA contains both double and single-stranded parts. The same repeat (TTAGGG)n is found in both but at the 3' end there is about 150 nt that are single stranded and form "blunt" ends. These proteins bind to the double-stranded bit even though the ChIP can only "see" what it is hybridizing to i.e. one strand of the DNA to which the protein was originally bound. Thanks Sandra Nancy fishikaw@lif.kyoto-u.ac.jp 28-Oct_2013: Contacted by IntAct-Help. Only protein-protein interactions human-143b Human bone osteosarcoma 143B 143b Human bone osteosarcoma 143B fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Miyake Y., Nakamura M., Nabetani A., Shimamura S., Tamura M., Yonehara S., Saito M., Ishikawa F. Cardiac - Interactions involving cardiac related proteins Dear Sandra, I am sorry. Yes, you are right. The telomeric DNA should be double-stranded in this case. So yes please, is it possible to add the other strand (TTAGGG)4 at the level of the database (I am guessing from your suggestion that I can't do it). However, telomeric DNA contains both double and single-stranded parts. The same repeat (TTAGGG)n is found in both but at the 3' end there is about 150 nt that are single stranded and form "blunt" ends. These proteins bind to the double-stranded bit even though the ChIP can only "see" what it is hybridizing to i.e. one strand of the DNA to which the protein was originally bound. Thanks Sandra Nancy fishikaw@lif.kyoto-u.ac.jp Accepted 2013-OCT-21 by ORCHARD 28-Oct_2013: Contacted by IntAct-Help. Mol. Cell (1097-2765) 2009 imex curation pote1_mouse Protection of telomeres protein 1 Pot1 Pot1a POT1-like telomere end-binding protein protein protein mouse Mus musculus Mouse MSLVSTAPYTYTPLNLLKEGTIANVYGVVKFFKPPYVSKGTDYCSVVTIVDQTNVKLTCMLFSGNYEALPIIYKVGDIVRFHRLKIQVYKNELQGINCSGFASLTFEGTVGMPVTARTSSKVFSFTPQDQKMVEALRVWASKHISASSTLVQLCDAQPMQYYDLTCQLLGKAQVDSTAFLLKVWDGTQTVLPSWRVSTQDLTFEGDLSHIERLQSLVVDILVYDNHVQVARSIEVGCFLRLYSLHTKLQPGNSETSSSESLRLEFHLHGGTSYGRGIRVLPDTSPCVDQLKKALEGANLPVTETSTGICQSENGDSSALSNSGSGAVSPYEEERCQQVSATILTNHQHLEKTPLCAILTQKAPQQYRVRAKLRSYLPRRLSQSVKLLCPKCHSVQEVPHGDSLDKILQDAATEAPDIKLKATSLYYSKVWTTEDQGGRQVAVHFVKNNGILPASSECLILIEGGRLCEVSKLSSKFHSVMPVRSGPESLELLTLSAPFLIQGKVHHYGCKQCSSLKPIQNLNSRFHKGPWTPSSVAEALGVVPLQYVFVMVFTLDDGTGVLEAYLKDSEHFFKIPASEVLTDDDLQRSLETIMDMICPPGIKVDAYPWLECLLKSYNVTIGTERRICYQIFDTTVAENVV DIP protein Q91WC1 original sequence version: 46 DIP protein Q91WC1 original sequence version: 77 mint Component of the telomerase ribonucleoprotein (RNP) complex that is essential for the replication of chromosome termini. Is a component of the double-stranded telomeric DNA-binding TRF1 complex which is involved in the regulation of telomere length by cis-inhibition of telomerase. Also acts as a single-stranded telomeric DNA-binding protein and thus may act as a downstream effector of the TRF1 complex and may transduce information about telomere maintenance and/or length to the telomere terminus. Binds to two or more telomeric single-stranded 5'-TTAGGG-3' repeats (G-strand) and with high specificity to a minimal telomeric single-stranded 5'-TAGGGTTAG-3' sequence. Binds telomeric single-stranded sequences internally or at proximity of a 3'-end. Its activity is TERT dependent but it does not increase TERT activity 64393BA48F14965E terf1_mouse Telomeric repeat-binding factor 1 Terf1 Trf1 TTAGGG repeat-binding factor 1 protein protein mouse Mus musculus Mouse MAETVSSAARDAPSREGWTDSDSPEQEEVGDDAELLQCQLQLGTPREMENAELVAEVEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRDSAEAIIHGLHRLTAYQLKTVYICQFLTRVASGKALDAQFEVDERITPLESALMIWNSIEKEHDKLHDEIKNLIKIQAVAVCMEIGSFKEAEEVFERIFGDPEFYTPLERKLLKIISQKDVFHSLFQHFSYSCMMEKIQSYVGDVLSEKSSTFLMKAATKVVENEKARTQASKDRPDATNTGMDTEVGLNKEKSVNGQQSTETEPLVDTVSSIRSHKNALSQLKHRRAPSDFSRNEARTGTLQCETTMERNRRTSGRNRLCVSENQPDTDDKSGRRKRQTWLWEEDRILKCGVKKYGEGNWAKILSHYKFNNRTSVMLKDRWRTMKRLKLIS DIP protein P70371 original sequence version: 123 3F648F18C3ECF20A ten1l_mouse CST complex subunit TEN1 Ten1 Protein telomeric pathways with STN1 homolog Telomere length regulation protein TEN1 homolog protein protein mouse Mus musculus Mouse MLPKPGVYYFPWEVSDGHVPEGSTLRTFGRLYLYDMARSLMTLAAPQKPDQCQLLVCTNLVEPFEAHVNFLYMVLGDLERMEGGAFVVRARLLTCVEGMDLSLLEKAILEQRRHLQKRQQPIGDASTLQTPTPAPQSIPSDSLSLEPENRGQQVPLPQTLD 4DACAD9187388A33 telomeric_dna_human_c-strand Human telomeric DNA ss dna single stranded deoxyribonucleic acid ss DNA ss dna human Homo sapiens Human CCCTAACCCTAACCCTAACCCTAA ten1l_human CST complex subunit TEN1 TEN1 C17orf106 Telomere length regulation protein TEN1 homolog Protein telomeric pathways with STN1 homolog protein protein human Homo sapiens Human MMLPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLVCTKLVEPFHAQVGSLYIVLGELQHQQDRGSVVKARVLTCVEGMNLPLLEQAIREQRLYKQERGGSQ DIP protein Q86WV5 original sequence version: 53 C713E9B40C2A5E34 tpz1_schpo Protection of telomeres protein tpz1 tpz1 mug169 Meiotically up-regulated gene 169 protein SPAC6F6.16c SPAC6F6.18c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSNCLKHPWLENGLLNLIKNADVLPIRVFKCQPLQIFEYIRYEHPIRCKLSDTEFYIEAEFSSQSISDLNNFTEKRITSLRGGIVTLGNFLIHLIPSQSGIIPWIQVESFNFQGCEGAVFGNPKAITTSALFNALLQSPYLAALANEFNRSIKEGSSYQEASLSQQEKPNDNTSNSRDIKNNIQFHWKNMTSLSIEECIIPKGQQLILEKESEENTTHGIYLEERKMAQGLHNSVSETPEVKQEDNDEDLDAYSWSSSTDSAGEIPSLPTNRKILEKIAEKPPPFESPLEDDETPDQTNEHEANQVNVSQLPLNPRGSGISGRPVESTEQLNSSLTIERSQSIQSTDSKQRVETQSHRRSKIEIFDAQDELFDRSICTTIDDSTGKLLNAEETPIKTGDLHSTSASSVISCTPPAINFTSDICNEQIELEYKRKPIPDYDFMKGLETTLQELYVEHQSKKRRLELFQLTNNHQKNSEACEMCRLGLPHGSFFELLRDWKKIEEFRNKS A1A2F59238DACBF7 A1A2F59238DACBF7 ctc1_human CST complex subunit CTC1 HBV DNAPTP1-transactivated protein B C17orf68 Conserved telomere maintenance component 1 CTC1 protein protein human Homo sapiens Human MAAGRAQVPSSEQAWLEDAQVFIQKTLCPAVKEPNVQLTPLVIDCVKTVWLSQGRNQGSTLPLSYSFVSVQDLKTHQRLPCCSHLSWSSSAYQAWAQEAGPNGNPLPREQLLLLGTLTDLSADLEQECRNGSLYVRDNTGVLSCELIDLDLSWLGHLFLFPRWSYLPPARWNSSGEGHLELWDAPVPVFPLTISPGPVTPIPVLYPESASCLLRLRNKLRGVQRNLAGSLVRLSALVKSKQKAYFILSLGRSHPAVTHVSIIVQVPAQLVWHRALRPGTAYVLTELRVSKIRGQRQHVWMTSQSSRLLLLKPECVQELELELEGPLLEADPKPLPMPSNSEDKKDPESLVRYSRLLSYSGAVTGVLNEPAGLYELDGQLGLCLAYQQFRGLRRVMRPGVCLQLQDVHLLQSVGGGTRRPVLAPCLRGAVLLQSFSRQKPGAHSSRQAYGASLYEQLVWERQLGLPLYLWATKALEELACKLCPHVLRHHQFLQHSSPGSPSLGLQLLAPTLDLLAPPGSPVRNAHNEILEEPHHCPLQKYTRLQTPSSFPTLATLKEEGQRKAWASFDPKALLPLPEASYLPSCQLNRRLAWSWLCLLPSAFCPAQVLLGVLVASSHKGCLQLRDQSGSLPCLLLAKHSQPLSDPRLIGCLVRAERFQLIVERDVRSSFPSWKELSMPGFIQKQQARVYVQFFLADALILPVPRPCLHSATPSTPQTDPTGPEGPHLGQSRLFLLCHKEALMKRNFCVPPGASPEVPKPALSFYVLGSWLGGTQRKEGTGWGLPEPQGNDDNDQKVHLIFFGSSVRWFEFLHPGQVYRLIAPGPATPMLFEKDGSSCISRRPLELAGCASCLTVQDNWTLELESSQDIQDVLDANKSLPESSLTDLLSDNFTDSLVSFSAEILSRTLCEPLVASLWMKLGNTGAMRRCVKLTVALETAECEFPPHLDVYIEDPHLPPSLGLLPGARVHFSQLEKRVSRSHNVYCCFRSSTYVQVLSFPPETTISIPLPHIYLAELLQGGQSPFQATASCHIVSVFSLQLFWVCAYCTSICRQGKCTRLGSTCPTQTAISQAIIRLLVEDGTAEAVVTCRNHHVAAALGLCPREWASLLDFVQVPGRVVLQFAGPGAQLESSARVDEPMTMFLWTLCTSPSVLRPIVLSFELERKPSKIVPLEPPRLQRFQCGELPFLTHVNPRLRLSCLSIRESEYSSSLGILASSC EF6B3985C72FDA6E poz1_schpo Protection of telomeres protein poz1 poz1 Pot1-associated protein poz1 SPAC19G12.13c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MNEKIRSQSVLNTLETFFIKENHYDMQREESSIVNACLRYLGYSKSMCHEKMPIFMDIAFIEYCFNLSLDPSSFQNLPITQTQPDSQQILWEYSLISNALERLENIELERQNCMREDGLVKYTNELLLNKETLNNEALKLYSCAKAGICRWMAFHFLEQEPIDHINFTKFLQDWGSHNEKEMEALQRLSKHKIRKRLIYVSQHKKKMPWSKFNSVLSRYIQCTKLQLEVFCDYDFKQREIVKMLTSNIN 6051EE0973BC3971 ctc1_mouse CST complex subunit CTC1 Ctc1 Alpha-accessory factor of 132 kDa Conserved telomere maintenance component 1 protein protein mouse Mus musculus Mouse MAACRAQPPTSEQAWLEAAQTFIQETLCPAGKEVDKELTRSVIACVKETWLSQGENQDLTLPFSYSFVSVQSLKTHQRLPCCSHLSWSQSAYQAWTRGGRPGDGVLPREQLILLGTLVDLLGDSEQECRSGSLYVRDNTGTLDCELIDLDLSWLGHLFLFPSWSYLPSAKRNSLGEGHLELWGTPVPVFPLTVSPGPLIPIPVLYPEKASHLLRYRKKSSIKEINLAGKLVHLSALIITQNKRYFIMTLGELAQAGSQVSIIVQIPAQMVWHRVLRPGRAYVLTKLQVTKTRIHLSCIWTTIPSSTLKPLRPGYVQELELDLEFSKADLKPPPQPTSSKDSRGQEGLVRASKVLHYLGTVTAVLHESAGLYILDGQLILCLAYQKIHGLRRVIRPGVCLELRDVHLLQAVGGATTKPVLALCLHGTVRLQGFSCLKPLTLPSSKVYGASLYEQLVWKCQLGLPLYLWAAKTLEDLIYKLCPHVLRCHQFLKQPSPGKPSLGLQLLAPSWDVLIPPGSPMRHAYSEILEEPHNCPLQKYTPLQTPYSFPTMLALAEEGQHRAWATFDPKAMLPLPEASHLTSCQLNRHLAWSWVCLPSCVFQPAQVLLGVLVASSRKGCLELRDLRGSLPCIPLTESSQPLIDPNLVGCLVRVEKFQLVVEREVRSSFPSWEEMGMARFIQKKQARVYVQFYLADALILPVPRPTFGSEPSQTASSCPEGPHLGQSRLFLLSHKEALMKRNFCLLPGDSSQPAKPTLSFHVSGTWLCGTQRKEGSGWSPPESLAVESKDQKVFLIFLGSSVRWFPFLYPNQVYRLVASGPSQTPVFETEGSAGTSRRPLELADCGSCLTVQEEWTLELGSSQDIPNVLEVPRTLPESSLAQLLGDNSPDSLVSFSAEILSRILCEPPLALRRMKPGNAGAIKTGVKLTVALEMDDCEYPPHLDIYIEDPQLPPQIGLLPGARVHFSQLEKRISRSNIVYCCFRSSTSVQVLSFPPETKASAPLPHIYLAELLQGDRPPFQATTSCHIVYVLSLQILWVCAHCTSICPQGKCSRRDPSCPSQRAVSQANIRLLVEDGTAEATVICRNHLVARALGLSPSEWSSILEHARGPGRVALQFTGLGGQTESASKTHEPLTLLLRTLCTSPFVLRPVKLSFALERRPTDISPREPSRLQQFQCGELPLLTRVNPRLRLVCLSLQEPELPNPPQASAASS 4254E5B091CA5E1D stn1_human CST complex subunit STN1 STN1 OBFC1 Oligonucleotide/oligosaccharide-binding fold-containing protein 1 Suppressor of cdc thirteen homolog protein protein human Homo sapiens Human MQPGSSRCEEETPSLLWGLDPVFLAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSAAPSAARELSLTSQLKKLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDPVWNIQIARMLELPTIYRKVYDQPFHSSALEKEEALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFYQQELEMVESLLSLANQPVIHSASSDQVNFKKDTTSKAIHSIFKNAIQLLQEKGLVFQKDDGFDNLYYVTREDKDLHRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLELLEDQSDIVSTMEHYYTAF DIP protein Q9H668 original sequence version: 89 087E7EF75544A1F0 stn1_mouse CST complex subunit STN1 Stn1 Alpha-accessory factor of 44 kDa Obfc1 Oligonucleotide/oligosaccharide-binding fold-containing protein 1 Suppressor of cdc thirteen homolog protein protein mouse Mus musculus Mouse MPQPCLLMECESSPREEEIPPLFWGLDPVFLAFAKLYIKDILEMKESQQVPGTYFYNGHPIRRVDIMGAVISVKERETFYSYGVDDATGVINCVCWKKLSNAESSSDPAILSTARELSMTSQLKKLQETIEQKTRIGIGDIIRVRGSVRMFREEREICANIYYKVDDPVWNMQIARMLELPKLYQKVYDQPFRNPALQEEEALNNKDNLDLAGLTSLLSEKIKEFLQEKKMQSFYQQELETVESLQSLASRPVTHSTGSDQVELKDSGTSGVAQRVFKNALQLLQEKGLVFQRDSGSDKLYYVTTKDKDLQQKIYHIIKEDCQKPNHMEKGCHLLHILNCVHLNLRWDLSKAVLQRVLELLEDQSDIVSTADHYYAAF 23C7FC13A10C6F1F terf2_human Telomeric repeat-binding factor 2 TTAGGG repeat-binding factor 2 Telomeric DNA-binding protein TERF2 TRF2 TRBF2 protein protein human Homo sapiens Human MAAGAGTAGPASGPGVVRDPAASQPRKRPGREGGEGARRSDTMAGGGGSSDGSGRAAGRRASRSSGRARRGRHEPGLGGPAERGAGEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGKEHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNIIREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKALKSESAASSTGKEDKQPAPGPVEKPPREPARQLRNPPTTIGMMTLKAAFKTLSGAQDSEAAFAKLDQKDLVLPTQALPASPALKNKRPRKDENESSAPADGEGGSELQPKNKRMTISRLVLEEDSQSTEPSAGLNSSQEAASAPPSKPTVLNQPLPGEKNPKVPKGKWNSSNGVEEKETWVEEDELFQVQAAPDEDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN DIP protein Q15554 original sequence version: 107 DIP protein Q15554 original sequence version: 109 DIP protein Q15554 original sequence version: 121 DIP protein Q15554 original sequence version: 157 DIP protein Q15554-3 original sequence version: 115 3A278AC6B594C43A terf1_human Telomeric repeat-binding factor 1 TTAGGG repeat-binding factor 1 NIMA-interacting protein 2 Telomeric protein Pin2/TRF1 TERF1 PIN2 TRF TRF1 TRBF1 protein protein human Homo sapiens Human MAEDVSSAAPSPRGCADGRDADPTEEQMAETERNDEEQFECQELLECQVQVGAPEEEEEEEEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQLRTIYICQFLTRIAAGKTLDAQFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDPNSHMPFKSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVESKRTRTITSQDKPSGNDVEMETEANLDTRKSVSDKQSAVTESSEGTVSLLRSHKNLFLSKLQHGTQQQDLNKKERRVGTPQSTKKKKESRRATESRIPVSKSQPVTPEKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKLKLISSDSED DIP protein P54274 original sequence version: 121 DIP protein P54274-1 original sequence version: 81 DIP protein P54274 original sequence version: 168 AB548E7D3124A211 obfc1-telomeric-1 2 19 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association Figure 1 G left terf2-telomeric 4 20 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association Figures 1 G right, 3 J and 3 K terf1-telomeric 2 10 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association Figure 1 G left pot1-telomeric 2 9 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association Figure 1 G left terf1-telomeric-1 4 21 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association Figures 1 G right and 3 J ctc1-telomeric 4 15 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association Figures 3 J Top and 3 K obfc1-ctc1 5 11 unspecified role unspecified role prey prey cell lysate cell lysate 19 unspecified role unspecified role bait bait cell lysate cell lysate ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey cell lysate cell lysate association association Figure 2 A ctc1-obfc1-8 3 13 unspecified role unspecified role neutral component neutral component cell lysate cell lysate ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role neutral component neutral component ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role neutral component neutral component cell lysate cell lysate flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Figure 2 C ctc1-obfc1-3 1 15 unspecified role unspecified role bait bait cell lysate cell lysate flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 3 A and figure 5 A lane 7 obfc1-ctc1-1 1 18 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey cell lysate cell lysate flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 3 B ten1-obfc1 1 18 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait cell lysate cell lysate flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 3 C and figure 5 A lane 10 obfc1-ctc1-3 1 18 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey cell lysate cell lysate flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 3 D obfc1-ten1-1 7 13 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait physical association physical association Figure 3 G ctc1-obfc1-4 7 15 unspecified role unspecified role bait bait binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role prey prey physical association physical association Figure 3 G ctc1-obfc1-5 6 18 unspecified role unspecified role neutral component neutral component fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role neutral component neutral component fixed cell fixed cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Figure 3 H ten1-telomeric 4 13 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association Figures 3 J bottom and 3 K ctc1-obfc1-7 1 18 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait cell lysate cell lysate binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Figure 5 A lanes 3 and 8, and figure 5 D Author states that HA-hStn1 and HA-hTen1 were coimmunoprecipitated with Flag-hCtc1 from 293T extracts expressing these proteins, indicating that hCtc1-hStn1 and hCtc1-hStn1-hTen1 complexes were formed (Figure 5A, lanes 3, 7, and 8). Interestingly, the amount of immunoprecipitated hStn1 was significantly smaller in hCtc1-hStn1-expressing cells than in the three-component-expressing cells, suggesting that the hCtc1-hStn1 subcomplex is relatively unstable. obfc1-terf1 8 18 anti-tag immunocytochemistry anti-tag immunocytochemistry immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role neutral component neutral component fixed cell fixed cell colocalization colocalization Figure 6 C This experiment was conducted in Pot1 knock-down cells by using an shRNA toward Pot1. Author states that the frequencies of colocalized HA-hStn1 signals among total TRF1 IF signals did not significantly change. These results indicate that CST is localized at telomeres independently of Pot1. obfc1-telomeric-1 4 18 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association Figures 1 G right and 3 K poz1-tpz1 7 16 unspecified role unspecified role unspecified role unspecified role 14 unspecified role unspecified role unspecified role unspecified role physical association physical association Figure 3G