bhf-ucl A human telomerase holoenzyme protein required for Cajal body localization and telomere synthesis. A human telomerase holoenzyme protein required for Cajal body localization and telomere synthesis. Science (0036-8075) 2009 imex curation Venteicher A.S., Abreu E.B., Meng Z., McCann K.E., Terns R.M., Veenstra T.D., Terns M.P., Artandi S.E. Cardiac - Interactions involving cardiac related proteins I did not enter IF colocalisation in Figure 3 A & B because I thought P80-coilin is used only because it is an indicator of a particular subcellular location i.e. so should not be captured. Is this right? - Correct (Sandra) Interactions involving NAF1 and WRAP53 constructs could not be captured as the origin of these constructs could not be traced. sartandi@stanford.edu 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH tap tandem affinity purification TAP TAP tap sequence tag sequence tag identification sequence tag Venteicher A.S., Abreu E.B., Meng Z., McCann K.E., Terns R.M., Veenstra T.D., Terns M.P., Artandi S.E. Cardiac - Interactions involving cardiac related proteins I did not enter IF colocalisation in Figure 3 A & B because I thought P80-coilin is used only because it is an indicator of a particular subcellular location i.e. so should not be captured. Is this right? - Correct (Sandra) Interactions involving NAF1 and WRAP53 constructs could not be captured as the origin of these constructs could not be traced. sartandi@stanford.edu Accepted 2013-OCT-07 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. Science (0036-8075) 2009 imex curation A human telomerase holoenzyme protein required for Cajal body localization and telomere synthesis. A human telomerase holoenzyme protein required for Cajal body localization and telomere synthesis. Science (0036-8075) 2009 imex curation Venteicher A.S., Abreu E.B., Meng Z., McCann K.E., Terns R.M., Veenstra T.D., Terns M.P., Artandi S.E. Cardiac - Interactions involving cardiac related proteins I did not enter IF colocalisation in Figure 3 A & B because I thought P80-coilin is used only because it is an indicator of a particular subcellular location i.e. so should not be captured. Is this right? - Correct (Sandra) Interactions involving NAF1 and WRAP53 constructs could not be captured as the origin of these constructs could not be traced. sartandi@stanford.edu 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Venteicher A.S., Abreu E.B., Meng Z., McCann K.E., Terns R.M., Veenstra T.D., Terns M.P., Artandi S.E. Cardiac - Interactions involving cardiac related proteins I did not enter IF colocalisation in Figure 3 A & B because I thought P80-coilin is used only because it is an indicator of a particular subcellular location i.e. so should not be captured. Is this right? - Correct (Sandra) Interactions involving NAF1 and WRAP53 constructs could not be captured as the origin of these constructs could not be traced. sartandi@stanford.edu Accepted 2013-OCT-07 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. Science (0036-8075) 2009 imex curation A human telomerase holoenzyme protein required for Cajal body localization and telomere synthesis. A human telomerase holoenzyme protein required for Cajal body localization and telomere synthesis. Science (0036-8075) 2009 imex curation Venteicher A.S., Abreu E.B., Meng Z., McCann K.E., Terns R.M., Veenstra T.D., Terns M.P., Artandi S.E. Cardiac - Interactions involving cardiac related proteins I did not enter IF colocalisation in Figure 3 A & B because I thought P80-coilin is used only because it is an indicator of a particular subcellular location i.e. so should not be captured. Is this right? - Correct (Sandra) Interactions involving NAF1 and WRAP53 constructs could not be captured as the origin of these constructs could not be traced. sartandi@stanford.edu 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip polyclonal western polyclonal antibody western blot polyclonal western Venteicher A.S., Abreu E.B., Meng Z., McCann K.E., Terns R.M., Veenstra T.D., Terns M.P., Artandi S.E. Cardiac - Interactions involving cardiac related proteins I did not enter IF colocalisation in Figure 3 A & B because I thought P80-coilin is used only because it is an indicator of a particular subcellular location i.e. so should not be captured. Is this right? - Correct (Sandra) Interactions involving NAF1 and WRAP53 constructs could not be captured as the origin of these constructs could not be traced. sartandi@stanford.edu Accepted 2013-OCT-07 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. Science (0036-8075) 2009 imex curation gar1_human H/ACA ribonucleoprotein complex subunit 1 GAR1 NOLA1 snoRNP protein GAR1 Nucleolar protein family A member 1 protein protein human Homo sapiens Human MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRGH 48CF04B78836EF91 nolc1_human Nucleolar and coiled-body phosphoprotein 1 NOLC1 KIAA0035 Nucleolar 130 kDa protein 140 kDa nucleolar phosphoprotein Nucleolar phosphoprotein p130 Hepatitis C virus NS5A-transactivated protein 13 NS5ATP13 protein protein human Homo sapiens Human MADAGIRRVVPSDLYPLVLGFLRDNQLSEVANKFAKATGATQQDANASSLLDIYSFWLKSAKVPERKLQANGPVAKKAKKKASSSDSEDSSEEEEEVQGPPAKKAAVPAKRVGLPPGKAAAKASESSSSEESSDDDDEEDQKKQPVQKGVKPQAKAAKAPPKKAKSSDSDSDSSSEDEPPKNQKPKITPVTVKAQTKAPPKPARAAPKIANGKAASSSSSSSSSSSSDDSEEEKAAATPKKTVPKKQVVAKAPVKAATTPTRKSSSSEDSSSDEEEEQKKPMKNKPGPYSSVPPPSAPPPKKSLGTQPPKKAVEKQQPVESSEDSSDESDSSSEEEKKPPTKAVVSKATTKPPPAKKAAESSSDSSDSDSSEDDEAPSKPAGTTKNSSNKPAVTTKSPAVKPAAAPKQPVGGGQKLLTRKADSSSSEEESSSSEEEKTKKMVATTKPKATAKAALSLPAKQAPQGSRDSSSDSDSSSSEEEEEKTSKSAVKKKPQKVAGGAAPSKPASAKKGKAESSNSSSSDDSSEEEEEKLKGKGSPRPQAPKANGTSALTAQNGKAAKNSEEEEEEKKKAAVVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKFDSE 7C5C4F25677E2E61 nhp2_human H/ACA ribonucleoprotein complex subunit 2 Nucleolar protein family A member 2 snoRNP protein NHP2 NHP2 NOLA2 HSPC286 protein protein human Homo sapiens Human MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL 7658FDFF88AF3178 ruvb1_human RuvB-like 1 RUVBL1 NMP238 TIP49 TIP49A 49 kDa TATA box-binding protein-interacting protein TIP49a Pontin 52 Nuclear matrix protein 238 54 kDa erythrocyte cytosolic protein INO80H TIP60-associated protein 54-alpha INO80 complex subunit H protein protein human Homo sapiens Human MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK DIP protein Q9Y265 original sequence version: 82 DIP protein Q9Y265 original sequence version: 110 6095ADE692B1482B tcab1_human Telomerase Cajal body protein 1 TCAB1 WDR79 WD repeat-containing protein 79 WRAP53 WD40 repeat-containing protein antisense to TP53 gene protein protein human Homo sapiens Human MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAGSAVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPDGSCILTNSADNILRIYNLPPELYHEGEQVEYAEMVPVLRMVEGDTIYDYCWYSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLYACGSYGRSLGLYAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTESGDEGEELGLPLLSTRHVHLECRLQLWWCGGAPDSSIPDDHQGEKGQGGTEGGVGELI DIP protein Q9BUR4 original sequence version: 79 4687517268A813B5 naf1_human H/ACA ribonucleoprotein complex non-core subunit NAF1 NAF1 protein protein human Homo sapiens Human MEVVEAAAAQLETLKFNGTDFGVGEGPAAPSPGSAPVPGTQPPLQSFEGSPDAGQTVEVKPAGEQPLQPVLNAVAAGTPAPQPQPPAESPACGDCVTSPGAAEPARAPDSLETSDSDSDSDSETDSDSSSSSSSSSSSSSSSSSSCISLPPVLSDGDDDLQIEKENKNFPLKTKDELLLNELPSVEELTIILPEDIELKPLGMVSSIIEQLVIIESMTNLPPVNEETVIFKSDRQAAGKIFEIFGPVAHPFYVLRFNSSDHIESKGIKIKETMYFAPSMKDFTQYIFTEKLKQDKGSDASWKNDQEPPPEALDFSDDEKEKEAKQRKKSQIQGRKKLKSEFNEPGEDFTEVHQNWNAHSSASEHAKGYRNREFTRGFSRARYPRSCHGRPPPQHFYNSEHMVSQETSGFPSQRQNNPIMPQYPFPLPVFDMHNFPLRPPPPPPPPPVNMGWATPNMAAHPLLNLPYSLPPPPPPPPLPPPPSSGDSNSHFGPYY 5A0C9B635A982A62 terc_human_rna Human telomerase RNA rna ribonucleic acid RNA rna human Homo sapiens Human GGGUUGCGGAGGGUGGGCCUGGGAGGGGUGGUGGCCAUUUUUUGUCUAACCCUAACUGAGAAGGGCGUAGGCGCCGUGCUUUUGCUCCCCGCGCGCUGUUUUUCUCGCUGACUUUCAGCGGGCGGAAAAGCCUCGGCCUGCCGCCUUCCACCGUUCAUUCUAGAGCAAACAAAAAAUGUCAGCUGCUGGCCCGUUCGCCCCUCCCGGGGACCUGCGGCGGGUCGCCUGCCCAGCCCCCGAACCCCGCCUGGAGGCCGCGGUCGGCCCGGGGCUUCUCCGGAGGCACCCACUGCCACCGCGAAGAGUUGGGCUCUGUCAGCCGCGGGUCUCUCGGGGGCGAGGGCGAGGUUCAGGCCUUUCAGGCCGCAGGAAGAGGAACGGAGCGAGUCCCCGCGCGCGGCGCGAUUCCCUGAGCUGUGGGACGUGCACCCAGGACUCGGCUCACACAUGC nop10_human H/ACA ribonucleoprotein complex subunit 3 NOLA3 NOP10 Nucleolar protein family A member 3 snoRNP protein NOP10 Nucleolar protein 10 protein protein human Homo sapiens Human MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL DIP protein Q9NPE3 original sequence version: 90 62E9BCFFB27036FA ruvb2_human RuvB-like 2 RUVBL2 TIP48 TIP49B CGI-46 48 kDa TATA box-binding protein-interacting protein TIP49b Repressing pontin 52 51 kDa erythrocyte cytosolic protein INO80J TIP60-associated protein 54-beta INO80 complex subunit J protein protein human Homo sapiens Human MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS DIP protein Q9Y230 original sequence version: 92 DIP protein Q9Y230 original sequence version: 120 DIP protein Q9Y230 original sequence version: 142 DIP protein Q9Y230 original sequence version: 180 54C78E9C587D975A dkc1_human H/ACA ribonucleoprotein complex subunit DKC1 Dyskerin Nucleolar protein family A member 4 snoRNP protein DKC1 Nopp140-associated protein of 57 kDa Nucleolar protein NAP57 CBF5 homolog DKC1 NOLA4 protein protein human Homo sapiens Human MADAEVIILPKKHKKKKERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGIVRLHNAIEGGTQLSRALETLTGALFQRPPLIAAVKRQLRVRTIYESKMIEYDPERRLGIFWVSCEAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDHGIVAKIKRVIMERDTYPRKWGLGPKASQKKLMIKQGLLDKHGKPTDSTPATWKQEYVDYSESAKKEVVAEVVKAPQVVAEAAKTAKRKRESESESDETPPAAPQLIKKEKKKSKKDKKAKAGLESGAEPGDGDSDTTKKKKKKKKAKEVELVSE DIP protein O60832 original sequence version: 148 DIP protein O60832 original sequence version: 167 12474DBEEFEB471C tert_human Telomerase reverse transcriptase TERT EST2 TCS1 TRT Telomerase catalytic subunit HEST2 Telomerase-associated protein 2 protein protein human Homo sapiens Human MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPWDARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVRSYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGAATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEILAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRELSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKALFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHLQETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTLLCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNLRKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTFNRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD DIP protein O14746 original sequence version: 129 DIP protein O14746 original sequence version: 95 DIP protein O14746 original sequence version: 125 DIP protein O14746 original sequence version: 121 DIP protein O14746-1 original sequence version: 110 94E35469C4CA33A0 dkc1-gar1 1 11 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait tap tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range TAP tag + HA tag = AH3 tag as cited by author in reference PMID: 18358808 (cited as S1 in supplementary). 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association Figure 1A and 1B dkc1-naf1-1 3 12 unspecified role unspecified role prey prey cell lysate cell lysate 10 northern blot northern blot northen polyclonal western polyclonal antibody western blot polyclonal western unspecified role unspecified role prey prey cell lysate cell lysate 9 unspecified role unspecified role prey prey cell lysate cell lysate 7 unspecified role unspecified role prey prey cell lysate cell lysate Author states that anti-ruvb1 (anti-pontin) antibodies were validated previously in reference S1 PMID: 18358808 14 unspecified role unspecified role prey prey cell lysate cell lysate Author states that anti-tert polyclonal antibodies were validated previously in reference S1 PMID: 18358808 8 unspecified role unspecified role prey prey cell lysate cell lysate 13 unspecified role unspecified role bait bait cell lysate cell lysate n terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Figures 1C and 1D wrap53-dkc1 2 10 northern blot northern blot northen polyclonal western polyclonal antibody western blot polyclonal western unspecified role unspecified role prey prey cell lysate cell lysate 8 unspecified role unspecified role bait bait cell lysate cell lysate 14 unspecified role unspecified role prey prey cell lysate cell lysate Author states that anti-tert antibodies were validated previously in reference S1 PMID: 18358808 13 unspecified role unspecified role prey prey cell lysate cell lysate Author cites Venteicher et al., 2008 which cites Mochizuki et al., 2004 PMID: 15240872 as reference for anti-dyskerin polyclonal antibodies used. association association Figure 2B and S5A dkc1-naf1-2 3 12 unspecified role unspecified role prey prey cell lysate cell lysate 13 unspecified role unspecified role bait bait cell lysate cell lysate n terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role prey prey cell lysate cell lysate 9 unspecified role unspecified role prey prey cell lysate cell lysate 7 unspecified role unspecified role prey prey cell lysate cell lysate Author states that anti-ruvb1 (anti-pontin) antibodies were validated previously in reference S1 PMID: 18358808 association association Figures 1C and 1D This set of protein interactions are after RNase A treatment indicating that they occur through protein-protein contacts. naf1-dkc1 2 13 unspecified role unspecified role prey prey cell lysate cell lysate Author cites Venteicher et al., 2008 which cites Mochizuki et al., 2004 PMID: 15240872 as reference for anti-dyskerin polyclonal antibodies used. 9 unspecified role unspecified role bait bait cell lysate cell lysate association association Figure 2B and S5A