IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction of calcium/calmodulin-dependent protein kinase IIdeltaC with sorcin indirectly modulates ryanodine receptor function in cardiac myocytes. Interaction of calcium/calmodulin-dependent protein kinase IIdeltaC with sorcin indirectly modulates ryanodine receptor function in cardiac myocytes. Journal of molecular and cellular cardiology 2007 imex curation Anthony DF., Beattie J., Paul A., Currie S. Cardiac - Interactions involving cardiac related proteins Interactions involving the CaMKIIdeltaC construct have not been included as the origin of this construct cannot be traced and the corresponding author did not reply to a request for information. email sent 24/08/15; not expecting a reply so will have to delete all expts except for the accepted one. The donor of the CaMKIIdeltaC construct is "Prof R. Colbran"- who is mentioned on several of the "Rat" papers but who is not mentioned in context with any particular species of CaMKIIdeltaC; much of his work is Human associated, but not using CaMKIIdeltaC. The isoform identification was not easy - UniProt lists several isoforms but does not use the terms "A, B, C" etc... and NCBI Gene page does not even mention isoforms. susan.currie@strath.ac.uk 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro electrophoresis electrophoretic mobility-based method electrophoresis western blot western blot Immuno blot Immuno blot Anthony DF., Beattie J., Paul A., Currie S. Cardiac - Interactions involving cardiac related proteins Interactions involving the CaMKIIdeltaC construct have not been included as the origin of this construct cannot be traced and the corresponding author did not reply to a request for information. email sent 24/08/15; not expecting a reply so will have to delete all expts except for the accepted one. The donor of the CaMKIIdeltaC construct is "Prof R. Colbran"- who is mentioned on several of the "Rat" papers but who is not mentioned in context with any particular species of CaMKIIdeltaC; much of his work is Human associated, but not using CaMKIIdeltaC. The isoform identification was not easy - UniProt lists several isoforms but does not use the terms "A, B, C" etc... and NCBI Gene page does not even mention isoforms. susan.currie@strath.ac.uk Accepted 2015-SEP-22 AT 11:46 BST AT 11:46 BST by ORCHARD Journal of molecular and cellular cardiology 2007 Only protein-protein interactions imex curation imex curation sorcn_crigr Sorcin 22 kDa protein CP-22 V19 SRI protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MAYPGHPGAGGGYYPGGYGGAPGGPSFPGQTQDPLYGYFASVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDSDRSGTVDPQELQKALTTMGFRLNPQTVNSIAKRYSTSGKITFDDYIACCVKLRALTDSFRRRDSAQQGMVNFSYDDFIQCVMTV DA2AF8A9707561C5 sri-10 1 2 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 3C