bhf-ucl FKBP12 functions as an adaptor of the Smad7-Smurf1 complex on activin type I receptor. FKBP12 functions as an adaptor of the Smad7-Smurf1 complex on activin type I receptor. J. Mol. Endocrinol. (0952-5041) 2006 imex curation Yamaguchi T., Kurisaki A., Yamakawa N., Minakuchi K., Sugino H. Cardiac - Interactions involving cardiac related proteins akikuri@hotmail.com 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down anti tag western anti tag western blot anti tag western Yamaguchi T., Kurisaki A., Yamakawa N., Minakuchi K., Sugino H. Cardiac - Interactions involving cardiac related proteins akikuri@hotmail.com Accepted 2013-SEP-23 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. J. Mol. Endocrinol. (0952-5041) 2006 imex curation FKBP12 functions as an adaptor of the Smad7-Smurf1 complex on activin type I receptor. FKBP12 functions as an adaptor of the Smad7-Smurf1 complex on activin type I receptor. J. Mol. Endocrinol. (0952-5041) 2006 imex curation Yamaguchi T., Kurisaki A., Yamakawa N., Minakuchi K., Sugino H. Cardiac - Interactions involving cardiac related proteins akikuri@hotmail.com 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Yamaguchi T., Kurisaki A., Yamakawa N., Minakuchi K., Sugino H. Cardiac - Interactions involving cardiac related proteins akikuri@hotmail.com Accepted 2013-SEP-23 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. J. Mol. Endocrinol. (0952-5041) 2006 imex curation FKBP12 functions as an adaptor of the Smad7-Smurf1 complex on activin type I receptor. FKBP12 functions as an adaptor of the Smad7-Smurf1 complex on activin type I receptor. J. Mol. Endocrinol. (0952-5041) 2006 imex curation Yamaguchi T., Kurisaki A., Yamakawa N., Minakuchi K., Sugino H. Cardiac - Interactions involving cardiac related proteins akikuri@hotmail.com 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yamaguchi T., Kurisaki A., Yamakawa N., Minakuchi K., Sugino H. Cardiac - Interactions involving cardiac related proteins akikuri@hotmail.com Accepted 2013-SEP-23 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. J. Mol. Endocrinol. (0952-5041) 2006 imex curation FKBP12 functions as an adaptor of the Smad7-Smurf1 complex on activin type I receptor. FKBP12 functions as an adaptor of the Smad7-Smurf1 complex on activin type I receptor. J. Mol. Endocrinol. (0952-5041) 2006 imex curation Yamaguchi T., Kurisaki A., Yamakawa N., Minakuchi K., Sugino H. Cardiac - Interactions involving cardiac related proteins akikuri@hotmail.com 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yamaguchi T., Kurisaki A., Yamakawa N., Minakuchi K., Sugino H. Cardiac - Interactions involving cardiac related proteins no Prof Kurisaki was contacted twice (28 Aug and 12 Sept) re SMURF1 species , with no reply. SMURF1 interaction was not captured as SMURF1 species is unknown. akikuri@hotmail.com Accepted 2013-SEP-23 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. J. Mol. Endocrinol. (0952-5041) 2006 imex curation FKBP12 functions as an adaptor of the Smad7-Smurf1 complex on activin type I receptor. FKBP12 functions as an adaptor of the Smad7-Smurf1 complex on activin type I receptor. J. Mol. Endocrinol. (0952-5041) 2006 imex curation Yamaguchi T., Kurisaki A., Yamakawa N., Minakuchi K., Sugino H. Cardiac - Interactions involving cardiac related proteins akikuri@hotmail.com 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yamaguchi T., Kurisaki A., Yamakawa N., Minakuchi K., Sugino H. Cardiac - Interactions involving cardiac related proteins akikuri@hotmail.com Accepted 2013-SEP-23 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. J. Mol. Endocrinol. (0952-5041) 2006 imex curation fkb1a_human Peptidyl-prolyl cis-trans isomerase FKBP1A FKBP1A FKBP1 FKBP12 FK506-binding protein 1A Rotamase Immunophilin FKBP12 12 kDa FK506-binding protein Calstabin-1 protein protein human Homo sapiens Human MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE DIP protein P62942 original sequence version: 122 DIP protein P62942 original sequence version: 45 9CC8493C802540B4 smad6_human Mothers against decapentaplegic homolog 6 SMAD family member 6 SMAD6 MADH6 protein protein human Homo sapiens Human MFRSKRSGLVRRLWRSRVVPDREEGGSGGGGGGDEDGSLGSRAEPAPRAREGGGCGRSEVRPVAPRRPRDAVGQRGAQGAGRRRRAGGPPRPMSEPGAGAGSSLLDVAEPGGPGWLPESDCETVTCCLFSERDAAGAPRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKRLKERSLDTLLEAVESRGGVPGGCVLVPRADLRLGGQPAPPQLLLGRLFRWPDLQHAVELKPLCGCHSFAAAADGPTVCCNPYHFSRLCGPESPPPPYSRLSPRDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTRSKIGFGILLSKEPDGVWAYNRGEHPIFVNSPTLDAPGGRALVVRKVPPGYSIKVFDFERSGLQHAPEPDAADGPYDPNSVRISFAKGWGPCYSRQFITSCPCWLEILLNNPR DIP protein O43541 original sequence version: 127 A4B928AE2D34EBC2 acv1b_human Activin receptor type-1B ACVRLK4 Activin receptor type IB Serine/threonine-protein kinase receptor R2 Activin receptor-like kinase 4 ACVR1B ALK4 protein protein human Homo sapiens Human MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVELVGIIAGPVFLLFLIIIIVFLVINYHQRVYHNRQRLDMEDPSCEMCLSKDKTLQDLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSGGVHEEYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNIPNWWQSYEALRVMGKMMRECWYANGAARLTALRIKKTLSQLSVQEDVKI DIP protein P36896 original sequence version: 101 40A6C65CAA4C7573 smad7_human Mothers against decapentaplegic homolog 7 SMAD7 MADH7 MADH8 Mothers against decapentaplegic homolog 8 SMAD family member 7 protein protein human Homo sapiens Human MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGCCLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEVIFNSR DIP protein O15105 original sequence version: 121 DIP protein O15105 original sequence version: 131 DIP protein O15105 original sequence version: 139 acvr1b-fkbp1a-1 1 FKBP12 8 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role prey prey tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1 activin GO:0016915 Activin acts as an antagonist up to an hour of stimulation. After that activin signal is inhibited. acvr1b-fkbp1a-2 3 6 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ACT4 8 unspecified role unspecified role prey prey n-terminal vp16 ad vp16 activation domain vp16 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 3A activin fkbp1a-smad7-1 3 6 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey n-terminal vp16 ad vp16 activation domain vp16 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 3A activin fkbp1a-smad6-1 3 7 unspecified role unspecified role neutral component neutral component n-terminal vp16 ad vp16 activation domain vp16 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component region gal4 dna bd gal4 dna binding domain gal4 dna bd anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3A activin The interaction of FKBP12 to SMAD6 was weak fkbp1a-smad7-2 5 6 unspecified role unspecified role bait bait n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range This is a 6-myc tag. I think it should be added to the features. 9 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 3B activin smad7-fkbp1a-1 2 6 unspecified role unspecified role prey prey n-terminal region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 9 unspecified role unspecified role bait bait n-terminal region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. 4B constitutively active AKT4 (caAKT4) smad7-acvr1b-2 2 8 unspecified role unspecified role prey prey 5 myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P36896:p.Thr206Glu mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain T E Wed May 02 17:09:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr206glu' Tue Jun 30 15:50:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr206Glu' causes constitutively high kinase activity human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 9 unspecified role unspecified role bait bait n-terminal region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. 4C FKBP12 FK506 CHEBI:61049 smad7-acvr1b-1 2 8 unspecified role unspecified role prey prey 5 myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P36896:p.Thr206Glu mutation mutation certain certain sequence position certain certain certain sequence position certain T E Wed May 02 17:58:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr206glu' Tue Jun 30 19:42:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr206Glu' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. 4C FKBP12 EBI-6930763 binding is weak acvr1b-smad7-1 4 9 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait 5 myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P36896:p.Thr206Glu mutation mutation certain certain sequence position certain certain certain sequence position certain T E Wed May 02 17:50:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr206glu' Tue Jun 30 16:33:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr206Glu' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Fig. 5B FK506 F-FKBP12 SMURF1 was also present in this interaction but the source of the construct was not given.