IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Proteins encoded by human Down syndrome critical region gene 1-like 2 (DSCR1L2) mRNA and by a novel DSCR1L2 mRNA isoform interact with cardiac troponin I (TNNI3). Proteins encoded by human Down syndrome critical region gene 1-like 2 (DSCR1L2) mRNA and by a novel DSCR1L2 mRNA isoform interact with cardiac troponin I (TNNI3). Gene 2006 imex curation Canaider S., Facchin F., Griffoni C., Casadei R., Vitale L., Lenzi L., Frabetti F., D'Addabbo P., Carinci P., Zannotti M., Strippoli P. Cardiac - Interactions involving cardiac related proteins pierluigi.strippoli@unibo.it Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Canaider S., Facchin F., Griffoni C., Casadei R., Vitale L., Lenzi L., Frabetti F., D'Addabbo P., Carinci P., Zannotti M., Strippoli P. Cardiac - Interactions involving cardiac related proteins pierluigi.strippoli@unibo.it Accepted 2015-APR-30 by ORCHARD Gene 2006 imex curation Proteins encoded by human Down syndrome critical region gene 1-like 2 (DSCR1L2) mRNA and by a novel DSCR1L2 mRNA isoform interact with cardiac troponin I (TNNI3). Proteins encoded by human Down syndrome critical region gene 1-like 2 (DSCR1L2) mRNA and by a novel DSCR1L2 mRNA isoform interact with cardiac troponin I (TNNI3). Gene 2006 imex curation Canaider S., Facchin F., Griffoni C., Casadei R., Vitale L., Lenzi L., Frabetti F., D'Addabbo P., Carinci P., Zannotti M., Strippoli P. Cardiac - Interactions involving cardiac related proteins pierluigi.strippoli@unibo.it Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Canaider S., Facchin F., Griffoni C., Casadei R., Vitale L., Lenzi L., Frabetti F., D'Addabbo P., Carinci P., Zannotti M., Strippoli P. Cardiac - Interactions involving cardiac related proteins Human TNNI3 -as used in this assay, was supplied by Abcam:however more than one expression system is available from this supplier. pierluigi.strippoli@unibo.it Accepted 2015-MAY-15 by ORCHARD Gene 2006 Only protein-protein interactions imex curation imex curation altered Proteins encoded by human Down syndrome critical region gene 1-like 2 (DSCR1L2) mRNA and by a novel DSCR1L2 mRNA isoform interact with cardiac troponin I (TNNI3). Proteins encoded by human Down syndrome critical region gene 1-like 2 (DSCR1L2) mRNA and by a novel DSCR1L2 mRNA isoform interact with cardiac troponin I (TNNI3). Gene 2006 imex curation Canaider S., Facchin F., Griffoni C., Casadei R., Vitale L., Lenzi L., Frabetti F., D'Addabbo P., Carinci P., Zannotti M., Strippoli P. Cardiac - Interactions involving cardiac related proteins pierluigi.strippoli@unibo.it Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Canaider S., Facchin F., Griffoni C., Casadei R., Vitale L., Lenzi L., Frabetti F., D'Addabbo P., Carinci P., Zannotti M., Strippoli P. Cardiac - Interactions involving cardiac related proteins pierluigi.strippoli@unibo.it Accepted 2015-APR-30 by ORCHARD Gene 2006 imex curation tnni3_human Troponin I, cardiac muscle Cardiac troponin I TNNI3 TNNC1 protein protein human Homo sapiens Human MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES DIP protein P19429 original sequence version: 120 20A804F8C24AE1B0 q9uka8-1 Calcipressin-3 Down syndrome candidate region 1-like protein 2 Myocyte-enriched calcineurin-interacting protein 3 Regulator of calcineurin 3 RCAN3-1a,2,3,4,5 RCAN3 DSCR1L2 protein protein human Homo sapiens Human MLRDTMKSWNDSQSDLCSTDQEEEEEMIFGENEDDLDEMMDLSDLPTSLFACSVHEAVFEAREQKERFEALFTIYDDQVTFQLFKSFRRVRINFSKPEAAARARIELHETDFNGQKLKLYFAQVQMSGEVRDKSYLLPPQPVKQFLISPPASPPVGWKQSEDAMPVINYDLLCAVSKLGPGEKYELHAGTESTPSVVVHVCESETEEEEETKNPKQKIAQTRRPDPPTAALNEPQTFDCAL 91AB619F5E443FBD q9uka8-4 Calcipressin-3 Down syndrome candidate region 1-like protein 2 Myocyte-enriched calcineurin-interacting protein 3 Regulator of calcineurin 3 RCAN3 DSCR1L2 protein protein human Homo sapiens Human MLRDTMKSWNDSQSDLCSTDQEEEEEMIFGENEDDLDEMMDLSDLPTSLFACSVHEAVFEAREQKERNMNFTREQSRHPAWWFMSVKVKLKRKKRQKTPNRKLPRRGAPTLRPQR Ref.2 (AAW83514) sequence is in conflict in position: 106:R->Q. 09FA31CAE7A64D21 24wre-1 3 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association no figure rcan3-tnni3-1 1 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait exon2 sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association 4 The exon 2 encoded domain is the only amino acid sequence conserved between DSCR1L2 (isoform 1) and DSCR1L2-E2E5 (isoform 4) rcan3-tnni3-2 1 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait N/A sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association 4-2 The exon 2 encoded domain is the only amino acid sequence conserved between DSCR1L2 (isoform 1) and DSCR1L2-E2E5 (isoform 4) rcan3-tnni3-3 2 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait exon2 sufficient to bind sufficient binding region sufficient to bind range range range range n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 5 rcan3-tnni3-4 2 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait exon2 sufficient to bind sufficient binding region sufficient to bind range range range range n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 5