bhf-ucl Dominant negative dimerization of a mutant homeodomain protein in Axenfeld-Rieger syndrome. Dominant negative dimerization of a mutant homeodomain protein in Axenfeld-Rieger syndrome. Mol. Cell. Biol. (0270-7306) 2003 imex curation Saadi I., Kuburas A., Engle J.J., Russo A.F. Cardiac - Interactions involving cardiac related proteins GST tag in PITX2a is n-terminal and expressed in E. coli as described in ref. 4 (PMID: 9685346) PITX2a used in EMSA was also expressed in E. coli (ref. 4) The authors have stated that PITX2a is of Human origin (Q99697-3) and that the origin of Pit1 is Rat. andrew-russo@uiowa.edu 12-Nov-2014: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Saadi I., Kuburas A., Engle J.J., Russo A.F. Cardiac - Interactions involving cardiac related proteins GST tag in PITX2a is n-terminal and expressed in E. coli as described in ref. 4 (PMID: 9685346) PITX2a used in EMSA was also expressed in E. coli (ref. 4) andrew-russo@uiowa.edu Accepted 2014-NOV-03 by MGT Mol. Cell. Biol. (0270-7306) 2003 Only protein-protein interactions imex curation Dominant negative dimerization of a mutant homeodomain protein in Axenfeld-Rieger syndrome. Dominant negative dimerization of a mutant homeodomain protein in Axenfeld-Rieger syndrome. Mol. Cell. Biol. (0270-7306) 2003 imex curation Saadi I., Kuburas A., Engle J.J., Russo A.F. Cardiac - Interactions involving cardiac related proteins GST tag in PITX2a is n-terminal and expressed in E. coli as described in ref. 4 (PMID: 9685346) PITX2a used in EMSA was also expressed in E. coli (ref. 4) The authors have stated that PITX2a is of Human origin (Q99697-3) and that the origin of Pit1 is Rat. andrew-russo@uiowa.edu 12-Nov-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Saadi I., Kuburas A., Engle J.J., Russo A.F. Cardiac - Interactions involving cardiac related proteins GST tag in PITX2a is n-terminal and expressed in E. coli as described in ref. 4 (PMID: 9685346) PITX2a used in EMSA was also expressed in E. coli (ref. 4) andrew-russo@uiowa.edu Accepted 2014-NOV-03 by MGT Mol. Cell. Biol. (0270-7306) 2003 Only protein-protein interactions imex curation Dominant negative dimerization of a mutant homeodomain protein in Axenfeld-Rieger syndrome. Dominant negative dimerization of a mutant homeodomain protein in Axenfeld-Rieger syndrome. Mol. Cell. Biol. (0270-7306) 2003 imex curation Saadi I., Kuburas A., Engle J.J., Russo A.F. Cardiac - Interactions involving cardiac related proteins GST tag in PITX2a is n-terminal and expressed in E. coli as described in ref. 4 (PMID: 9685346) PITX2a used in EMSA was also expressed in E. coli (ref. 4) The authors have stated that PITX2a is of Human origin (Q99697-3) and that the origin of Pit1 is Rat. andrew-russo@uiowa.edu 12-Nov-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa autoradiography autoradiography Saadi I., Kuburas A., Engle J.J., Russo A.F. Cardiac - Interactions involving cardiac related proteins GST tag in PITX2a is n-terminal and expressed in E. coli as described in ref. 4 (PMID: 9685346) PITX2a used in EMSA was also expressed in E. coli (ref. 4) andrew-russo@uiowa.edu Accepted 2014-NOV-03 by MGT Mol. Cell. Biol. (0270-7306) 2003 Only protein-protein interactions imex curation q99697-3 Pituitary homeobox 2 ARP1A PITX2 ARP1 RGS RIEG RIEG1 ALL1-responsive protein ARP1 Homeobox protein PITX2 Paired-like homeodomain transcription factor 2 RIEG bicoid-related homeobox transcription factor Solurshin protein protein human Homo sapiens Human METNCRKLVSACVQLEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV Variant in position: 58:F->L (in ASGD4). 45D2ADA6DF03FF65 pit1_rat Pituitary-specific positive transcription factor 1 Pou1f1 Ghf-1 Pit-1 Pit1 Growth hormone factor 1 protein protein rat Rattus norvegicus (Rat) Rat MSCQPFTSADTFIPLNSDASAALPLRMHHSAAEGLPASNHATNVMSTATGLHYSVPSCHYGNQPSTYGVMAGTLTPCLYKFPDHTLSHGFPPLHQPLLAEDPTASEFKQELRRKSKLVEEPIDMDSPEIRELEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEHSKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR 2651876B2F7668A1 bcd 2x 5n Bcd 2x 5n dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid synthetic construct synthetic construct GATCCATCTAATCCCGTCGTAATCCGATGGATC bcd1x Bcd1x dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid synthetic construct synthetic construct GATCCGCACGGCCCATCTAATCCCGTGGGATC bcd 2x pal 5n Bcd 2x pal 5n dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid synthetic construct synthetic construct GATCCATCTAATCCCGTCGGGATTAGATGGATC pitx2-pitx2-4 1 4 unspecified role unspecified role bait bait c-terminal hd sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey Q99697-3:p.Thr68Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T P Wed May 02 15:18:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr68pro' Tue Jun 30 19:58:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr68Pro' physical association physical association Fig. 1A, 1B, 2B Even though the two interactors are the same protein they had different tags pitx2-pitx2-5 1 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey Q99697-3:p.Lys88Glu mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain K E Wed May 02 17:23:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys88glu' Tue Jun 30 18:28:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys88Glu' physical association physical association Fig. 2A The K88E mutant interaction with the the full length and the two C-terminal tail fragments showed a greater beta-galactosidase activity than the WT interaction. pitx2-pitx2-7 2 4 unspecified role unspecified role prey prey c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 4 unspecified role unspecified role bait bait n-teminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q99697-3:p.Lys88Arg mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain K R Wed May 02 16:31:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys88arg' Tue Jun 30 15:40:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys88Arg' Q99697-3:p.Lys88Glu mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain K E Wed May 02 14:40:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys88glu' Tue Jun 30 19:53:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys88Glu' ecoli Escherichia coli (strain K12) physical association physical association Fig. 3A, 3C, 3D, 9B bcd_2x_pal_5n-pitx2-1 3 4 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined synthetic construct synthetic construct direct interaction direct interaction Fig. 4B weak binding bcd_2x_5n-pitx2-6 3 4 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined synthetic construct synthetic construct 8 competitor competitor competitor unspecified role unspecified role synthetic construct synthetic construct 7 competitor competitor competitor unspecified role unspecified role synthetic construct synthetic construct 6 competitor competitor competitor unspecified role unspecified role synthetic construct synthetic construct physical association physical association Fig.5A, 5B bcd_2x_5n-pitx2-4 3 4 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined synthetic construct synthetic construct 6 competitor competitor competitor unspecified role unspecified role synthetic construct synthetic construct 7 competitor competitor competitor unspecified role unspecified role synthetic construct synthetic construct physical association physical association Fig. 5A, 5C bcd1x-pitx2 3 4 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined synthetic construct synthetic construct physical association physical association Fig. 4B, 6A Lys 88 Glu increases dimer formation bcd1x-pitx2-1 3 4 unspecified role unspecified role prey prey Q99697-3:p.Lys88Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K R Wed May 02 15:46:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys88arg' Tue Jun 30 16:44:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys88Arg' ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined synthetic construct synthetic construct direct interaction direct interaction Fig. 4B, 6A, 8B pitx2-pitx2-9 1 4 unspecified role unspecified role prey prey Q99697-3:p.Lys88Glu mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain K E Wed May 02 16:06:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys88glu' Tue Jun 30 19:36:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys88Glu' Q99697-3:p.Lys88Arg mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain K R Wed May 02 18:20:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys88arg' Tue Jun 30 17:48:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys88Arg' Q99697-3:p.Thr68Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T P Wed May 02 14:50:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr68pro' Tue Jun 30 17:22:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr68Pro' 4 unspecified role unspecified role bait bait physical association physical association Fig. 9A pitx2-pitx2-10 1 4 unspecified role unspecified role prey prey Q99697-3:p.Lys88Arg mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain K R Wed May 02 14:56:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys88arg' Tue Jun 30 19:06:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys88Arg' Q99697-3:p.Thr68Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T P Wed May 02 17:46:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr68pro' Tue Jun 30 18:48:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr68Pro' Q99697-3:p.Lys88Glu mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain K E Wed May 02 17:02:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys88glu' Tue Jun 30 20:14:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys88Glu' 4 unspecified role unspecified role bait bait Q99697-3:p.Lys88Arg mutation mutation certain certain sequence position certain certain certain sequence position certain K R Wed May 02 15:17:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys88arg' Tue Jun 30 15:51:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys88Arg' physical association physical association Fig. 9A pitx2-pou1f1 1 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait Q99697-3:p.Lys88Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K E Wed May 02 15:24:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys88glu' Tue Jun 30 17:19:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys88Glu' Q99697-3:p.Lys88Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K R Wed May 02 19:49:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys88arg' Tue Jun 30 17:07:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys88Arg' Q99697-3:p.Thr68Pro mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T P Wed May 02 18:36:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr68pro' Tue Jun 30 19:43:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr68Pro' physical association physical association Fig. 2C bcd_2x_5n-pitx2-7 3 4 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined synthetic construct synthetic construct direct interaction direct interaction Fig.4B, 6A, 6B bcd_2x_5n-pitx2-8 3 4 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined synthetic construct synthetic construct physical association physical association Fig. 4B, 6A, 6B Lys 88 Glu mutant increases the dimer formation