bhf-ucl Apolipoprotein AII enrichment of HDL enhances their affinity for class B type I scavenger receptor but inhibits specific cholesteryl ester uptake. Apolipoprotein AII enrichment of HDL enhances their affinity for class B type I scavenger receptor but inhibits specific cholesteryl ester uptake. Arterioscler. Thromb. Vasc. Biol. (1079-5642) 2000 imex curation Pilon A., Briand O., Lestavel S., Copin C., Majd Z., Fruchart J.C., Castro G., Clavey V. Cardiac - Interactions involving cardiac related proteins author states that the cell membrane preparations were performed as per reference Basu et al., 1978, PMID: 25894. Source of protein ApoA1 is human as it is isolated from human plasma as per author reference Mezdour et al., 1987, PMID: 3106390. Source of protein SR-B1 is human as it is endogenous to human cell line used. Veronique.Clavey@pasteur-lille.fr 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-nci_h295r Human NCI-H295R Adrenocortical Carcinoma nci_h295r Human NCI-H295R Adrenocortical Carcinoma http://www.lgcstandards-atcc.org/products/all/CRL-2128.aspx?geo_country=gb#357C3571006A4259B64650D34DF19048 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Pilon A., Briand O., Lestavel S., Copin C., Majd Z., Fruchart J.C., Castro G., Clavey V. Cardiac - Interactions involving cardiac related proteins author states that the cell membrane preparations were performed as per reference Basu et al., 1978, PMID: 25894. author states that the cell membrane preparations were performed as per reference Basu et al., 1978, PMID: 25894. Source of protein ApoA1 is human as it is isolated from human plasma as per author reference Mezdour et al., 1987, PMID: 3106390. Source of protein SR-B1 is human as it is endogenous to human cell line used. Veronique.Clavey@pasteur-lille.fr Accepted 2013-NOV-21 by ORCHARD Arterioscler. Thromb. Vasc. Biol. (1079-5642) 2000 imex curation Apolipoprotein AII enrichment of HDL enhances their affinity for class B type I scavenger receptor but inhibits specific cholesteryl ester uptake. Apolipoprotein AII enrichment of HDL enhances their affinity for class B type I scavenger receptor but inhibits specific cholesteryl ester uptake. Arterioscler. Thromb. Vasc. Biol. (1079-5642) 2000 imex curation Pilon A., Briand O., Lestavel S., Copin C., Majd Z., Fruchart J.C., Castro G., Clavey V. Cardiac - Interactions involving cardiac related proteins author states that the cell membrane preparations were performed as per reference Basu et al., 1978, PMID: 25894. Source of protein ApoA1 is human as it is isolated from human plasma as per author reference Mezdour et al., 1987, PMID: 3106390. Source of protein SR-B1 is human as it is endogenous to human cell line used. Veronique.Clavey@pasteur-lille.fr 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-nci_h295r Human NCI-H295R Adrenocortical Carcinoma nci_h295r Human NCI-H295R Adrenocortical Carcinoma http://www.lgcstandards-atcc.org/products/all/CRL-2128.aspx?geo_country=gb#357C3571006A4259B64650D34DF19048 bifunctional agent crosslink protein cross-linking with a bifunctional reagent Label transfer techniques Photoaffinity labelling Label transfer techniques Photoaffinity labelling bifunctional agent crosslink western blot western blot Immuno blot Immuno blot Pilon A., Briand O., Lestavel S., Copin C., Majd Z., Fruchart J.C., Castro G., Clavey V. Cardiac - Interactions involving cardiac related proteins author states that the cell membrane preparations were performed as per reference Basu et al., 1978, PMID: 25894. author states that the cell membrane preparations were performed as per reference Basu et al., 1978, PMID: 25894. Source of protein ApoA1 is human as it is isolated from human plasma as per author reference Mezdour et al., 1987, PMID: 3106390. Source of protein SR-B1 is human as it is endogenous to human cell line used. Veronique.Clavey@pasteur-lille.fr Accepted 2013-NOV-21 by ORCHARD Arterioscler. Thromb. Vasc. Biol. (1079-5642) 2000 imex curation apoa1_human Apolipoprotein A-I APOA1 Apolipoprotein A1 protein protein human Homo sapiens Human MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ DIP protein P02647 original sequence version: 116 DIP protein P02647 original sequence version: 125 DIP protein P02647 original sequence version: 147 DIP protein P02647 original sequence version: 162 1A28B8366E620310 scrb1_human Scavenger receptor class B member 1 SCARB1 CD36L1 CLA1 SR-BI CD36 antigen-like 1 CD36 and LIMPII analogous 1 Collagen type I receptor, thrombospondin receptor-like 1 protein protein human Homo sapiens Human MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEACRSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNADPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESGAMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQVGAGQRAARADSHSLACWGKGASDRTLWPTAAWSPPPAAVLRLCRSGSGHCWGLRSTLASFACRVATTLPVLEGLGPSLGGGTGS 06B0BD771FEA284F 1-hexadecanoyl-2-(9z-octadecenoyl)-sn-glycero-3-phosphocholine 1-hexadecanoyl-2-(9Z-octadecenoyl)-sn-glycero-3-phosphocholine 1-16:0-2-18:1-phosphatidylcholine 1-hexadecanoyl-2-(9Z-octadecenoyl)-sn-glycero-3-phosphocholine 1-hexadecanoyl-2-oleoyl-sn-glycero-3-phosphocholine 1-Palmitoyl-2-oleoyl-lecithin 1-Palmitoyl-2-oleoylphosphatidylcholine 1-Palmotoyl-2-oleoylglycero-3-phosphocholine 1-Popc 16:0-18:1-PC GPCho(16:0/18:1) GPCho(16:0/18:1omega9) GPCho(34:1) Lecithin Palmitoyloleoylphosphatidylcholine PC(16:0/18:1(9Z)) PC(16:0/18:1) PC(16:0/18:1) PC(16:0/18:1omega9) PC(34:1) Phosphatidylcholine(16:0/18:1) Phosphatidylcholine(16:0/18:1omega9) Phosphatidylcholine(34:1) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) WTJKGGKOPKCXLL-VYOBOKEXSA-N WTJKGGKOPKCXLL-VYOBOKEXSA-N 1_hexadecanoyl_2__9z_octadecenoyl__sn_glycero_3_phosphocholine-apoa1-2 2 5 unspecified role unspecified role ancillary ancillary 4 polyclonal western polyclonal antibody western blot polyclonal western western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component 3 monoclonal western monoclonal antibody western blot monoclonal western western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified physical association physical association Figures 1 A This binary interaction does not take place In the abscence of palmitoyl-oleoyl-phosphatidylcholine (POPC)-A1. scarb1-apoa1 1 4 polyclonal western polyclonal antibody western blot polyclonal western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait 3 monoclonal western monoclonal antibody western blot monoclonal western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified 5 unspecified role unspecified role ancillary ancillary physical association physical association Figures 1 B