IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification of homo- and heteromeric interactions between members of the breast carcinoma-associated D52 protein family using the yeast two-hybrid system. Identification of homo- and heteromeric interactions between members of the breast carcinoma-associated D52 protein family using the yeast two-hybrid system. Oncogene (0950-9232) 1998 imex curation Byrne JA., Nourse CR., Basset P., Gunning P. Cancer - Interactions investigated in the context of cancer 2 and 3 Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Byrne JA., Nourse CR., Basset P., Gunning P. Cancer - Interactions investigated in the context of cancer 2 and 3 Annotation to indicate that this entry has been checked and accepted by a senior curator. Oncogene (0950-9232) 1998 Only protein-protein interactions imex curation Identification of homo- and heteromeric interactions between members of the breast carcinoma-associated D52 protein family using the yeast two-hybrid system. Identification of homo- and heteromeric interactions between members of the breast carcinoma-associated D52 protein family using the yeast two-hybrid system. Oncogene (0950-9232) 1998 imex curation Byrne JA., Nourse CR., Basset P., Gunning P. Cancer - Interactions investigated in the context of cancer 2 and 3 Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Byrne JA., Nourse CR., Basset P., Gunning P. Cancer - Interactions investigated in the context of cancer 2 and 3 Annotation to indicate that this entry has been checked and accepted by a senior curator. Yeast two hybrid screening of a human breast carcinoma cDNA library in yeast strain Hf7c. Oncogene (0950-9232) 1998 Only protein-protein interactions imex curation Identification of homo- and heteromeric interactions between members of the breast carcinoma-associated D52 protein family using the yeast two-hybrid system. Identification of homo- and heteromeric interactions between members of the breast carcinoma-associated D52 protein family using the yeast two-hybrid system. Oncogene (0950-9232) 1998 imex curation Byrne JA., Nourse CR., Basset P., Gunning P. Cancer - Interactions investigated in the context of cancer 2 and 3 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Byrne JA., Nourse CR., Basset P., Gunning P. Cancer - Interactions investigated in the context of cancer 2 and 3 Annotation to indicate that this entry has been checked and accepted by a senior curator. Oncogene (0950-9232) 1998 Only protein-protein interactions imex curation Identification of homo- and heteromeric interactions between members of the breast carcinoma-associated D52 protein family using the yeast two-hybrid system. Identification of homo- and heteromeric interactions between members of the breast carcinoma-associated D52 protein family using the yeast two-hybrid system. Oncogene (0950-9232) 1998 imex curation Byrne JA., Nourse CR., Basset P., Gunning P. Cancer - Interactions investigated in the context of cancer 2 and 3 Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Byrne JA., Nourse CR., Basset P., Gunning P. Cancer - Interactions investigated in the context of cancer 2 and 3 Annotation to indicate that this entry has been checked and accepted by a senior curator. Two hybrid screening of a human breast carcinoma cDNA expression library in yeast strain Y190. Oncogene (0950-9232) 1998 Only protein-protein interactions imex curation o43399-2 Tumor protein D54 HD54-ins2 TPD52L2 Tumor protein D52-like 2 protein protein human Homo sapiens Human MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF 002CD68479D8250C tpd53_human Tumor protein D53 Tumor protein D52-like 1 TPD52L1 protein protein human Homo sapiens Human MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC 6B3C336D5C0653C9 tpd52_mouse Tumor protein D52 Tpd52 protein protein mouse Mus musculus Mouse MECRDMELADDYQSPFDFDSGVNKNYLYLSPSGNTSPPGSPTQNVGLLKTEPVAEEGEDAVTMLSAPEALTEEEQEELRRELTKVEEEIQTLSQVLAAKEKHLAELKRKLGISSLQEFKQNIAKGWQDVTATNAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGAKPAGGDFGEVLNSTANATSTMTTEPPPEQMTESP C80D8AB9038B0D73 tpd52_human Tumor protein D52 Protein N8 TPD52 protein protein human Homo sapiens Human MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKFGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL 4C8183C5914BB976 o43399-1 Tumor protein D54 HD54+ins2 TPD52L2 Tumor protein D52-like 2 protein protein human Homo sapiens Human MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF 58F01BC67B1E3DE9 hd52-hd52-1 1 8 unspecified role unspecified role prey prey in vitro In vitro 8 unspecified role unspecified role bait bait in vitro In vitro physical association physical association hd52-md52-1 1 7 unspecified role unspecified role prey prey partial md52 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-782600]The shifted ranges (1-202) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-782600]1-163 [EBI-782600]Q62393,1 in vitro In vitro 8 unspecified role unspecified role bait bait in vitro In vitro physical association physical association hd52-hd53-1 1 6 unspecified role unspecified role prey prey in vitro In vitro 8 unspecified role unspecified role bait bait in vitro In vitro physical association physical association hd52-hd54ins2-1 1 9 unspecified role unspecified role prey prey in vitro In vitro 8 unspecified role unspecified role bait bait in vitro In vitro physical association physical association hd52-hd54-ins2-1 1 5 unspecified role unspecified role prey prey in vitro In vitro 8 unspecified role unspecified role bait bait in vitro In vitro physical association physical association md52-hd53-1 1 6 unspecified role unspecified role prey prey in vitro In vitro 7 unspecified role unspecified role bait bait in vitro In vitro physical association physical association hd53-hd52-1 1 8 unspecified role unspecified role prey prey in vitro In vitro 6 unspecified role unspecified role bait bait in vitro In vitro physical association physical association hd53-md52-1 1 6 unspecified role unspecified role bait bait in vitro In vitro 7 unspecified role unspecified role prey prey partial md52 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-782637]The shifted ranges (1-202) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-782637]1-163 [EBI-782637]Q62393,1 in vitro In vitro physical association physical association hd53-hd53-1 1 6 unspecified role unspecified role prey prey in vitro In vitro 6 unspecified role unspecified role bait bait in vitro In vitro physical association physical association hd53-hd54ins2-1 1 6 unspecified role unspecified role bait bait in vitro In vitro 9 unspecified role unspecified role prey prey in vitro In vitro physical association physical association hd53-hd54-ins2-1 1 5 unspecified role unspecified role prey prey in vitro In vitro 6 unspecified role unspecified role bait bait in vitro In vitro physical association physical association hd54ins2-hd52-1 1 8 unspecified role unspecified role prey prey in vitro In vitro 9 unspecified role unspecified role bait bait in vitro In vitro physical association physical association hd54ins2-md52-1 1 9 unspecified role unspecified role bait bait in vitro In vitro 7 unspecified role unspecified role prey prey partial md52 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-782654]The shifted ranges (1-202) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-782654]1-163 [EBI-782654]Q62393,1 in vitro In vitro physical association physical association hd54ins2-hd53-1 1 6 unspecified role unspecified role prey prey in vitro In vitro 9 unspecified role unspecified role bait bait in vitro In vitro physical association physical association hd54ins2-hd54ins2-1 1 9 unspecified role unspecified role prey prey in vitro In vitro 9 unspecified role unspecified role bait bait in vitro In vitro physical association physical association hd54ins2-hd54-ins2-1 1 5 unspecified role unspecified role prey prey in vitro In vitro 9 unspecified role unspecified role bait bait in vitro In vitro physical association physical association hd54-ins2-hd52-1 1 5 unspecified role unspecified role bait bait in vitro In vitro 8 unspecified role unspecified role prey prey in vitro In vitro physical association physical association hd54-ins2-md52-1 1 5 unspecified role unspecified role bait bait in vitro In vitro 7 unspecified role unspecified role prey prey partial md52 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-782671]The shifted ranges (1-202) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-782671]1-163 [EBI-782671]Q62393,1 in vitro In vitro physical association physical association hd54-ins2-hd53-1 1 6 unspecified role unspecified role prey prey in vitro In vitro 5 unspecified role unspecified role bait bait in vitro In vitro physical association physical association hd54-ins2-hd54ins2-1 1 9 unspecified role unspecified role prey prey in vitro In vitro 5 unspecified role unspecified role bait bait in vitro In vitro physical association physical association hd54-ins2homodimer-1 1 5 unspecified role unspecified role bait bait in vitro In vitro 5 unspecified role unspecified role prey prey in vitro In vitro physical association physical association md52-hd53-2 1 7 unspecified role unspecified role bait bait n-term md52 N-terminus of mouse D52 required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-782685]The shifted ranges (1-134) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-782685]1-95 [EBI-782685]Q62393,1 in vitro In vitro 6 unspecified role unspecified role prey prey in vitro In vitro physical association physical association hd53-hd53-2 4 6 unspecified role unspecified role prey prey in vitro In vitro 6 unspecified role unspecified role bait bait in vitro In vitro physical association physical association hd53-hd53-3 4 6 unspecified role unspecified role bait bait in vitro In vitro 6 unspecified role unspecified role prey prey in vitro In vitro physical association physical association hd53-hd53-4 4 6 unspecified role unspecified role prey prey partial hd53 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 6 unspecified role unspecified role bait bait in vitro In vitro physical association physical association hd52-hd53-2 2 8 unspecified role unspecified role bait bait in vitro In vitro 6 unspecified role unspecified role prey prey partial hd53 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association hd52-hd52-2 2 8 unspecified role unspecified role bait bait in vitro In vitro 8 unspecified role unspecified role prey prey in vitro In vitro physical association physical association md52-md52-1 3 7 unspecified role unspecified role bait bait ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction md52-hd52-1 3 7 unspecified role unspecified role bait bait ecobb Escherichia coli (strain B / BL21) 8 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction md52-hd54_ins2-1 3 5 unspecified role unspecified role prey prey in vitro In vitro 7 unspecified role unspecified role bait bait ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction