MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Clinical relevance of lysyl oxidase-like 2 and functional mechanisms in glioma. Clinical relevance of lysyl oxidase-like 2 and functional mechanisms in glioma. OncoTargets and therapy 2017 imex curation Du XG., Zhu MJ. Cancer - Interactions investigated in the context of cancer I assumed that LOXL2 is human because the human gene name is the onl one written in capital letter. I did not add the colocalization because there is not information on YFP-Snail1 shuilongyinnn@126.com 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-u87-mg human-u87-mg u87-mg U87-MG anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Du XG., Zhu MJ. Cancer - Interactions investigated in the context of cancer I assumed that LOXL2 is human because the human gene name is the onl one written in capital letter. I did not add the colocalization because there is not information on YFP-Snail1 shuilongyinnn@126.com Accepted 2021-APR-04 AT 17:40 BST AT 17:40 BST by KALPANAP OncoTargets and therapy 2017 Only protein-protein interactions imex curation imex curation Clinical relevance of lysyl oxidase-like 2 and functional mechanisms in glioma. Clinical relevance of lysyl oxidase-like 2 and functional mechanisms in glioma. OncoTargets and therapy 2017 imex curation Du XG., Zhu MJ. Cancer - Interactions investigated in the context of cancer I assumed that LOXL2 is human because the human gene name is the onl one written in capital letter. I did not add the colocalization because there is not information on YFP-Snail1 shuilongyinnn@126.com 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-u87-mg human-u87-mg u87-mg U87-MG anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Du XG., Zhu MJ. Cancer - Interactions investigated in the context of cancer I assumed that LOXL2 is human because the human gene name is the onl one written in capital letter. I did not add the colocalization because there is not information on YFP-Snail1 shuilongyinnn@126.com Accepted 2021-APR-04 AT 17:40 BST AT 17:40 BST by KALPANAP OncoTargets and therapy 2017 Only protein-protein interactions imex curation imex curation hdac2_human Histone deacetylase 2 HDAC2 protein protein human Homo sapiens Human MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP DIP protein Q92769 original sequence version: 161 DIP protein Q92769 original sequence version: 154 DIP protein Q92769 original sequence version: 117 DIP protein Q92769 original sequence version: 113 DIP protein Q92769 original sequence version: 139 DIP protein Q92769 original sequence version: 163 DIP protein Q92769 original sequence version: 179 DIP protein Q92769 original sequence version: 153 DIP protein Q92769 original sequence version: 112 775419CCCDAE07FA loxl2_human Lysyl oxidase homolog 2 LOXL2 Lysyl oxidase-like protein 2 Lysyl oxidase-related protein 2 Lysyl oxidase-related protein WS9-14 protein protein human Homo sapiens Human MERPLCSHLCSCLAMLALLSPLSLAQYDSWPHYPEYFQQPAPEYHQPQAPANVAKIQLRLAGQKRKHSEGRVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSYGKGEGPIWLDNLHCTGNEATLAACTSNGWGVTDCKHTEDVGVVCSDKRIPGFKFDNSLINQIENLNIQVEDIRIRAILSTYRKRTPVMEGYVEVKEGKTWKQICDKHWTAKNSRVVCGMFGFPGERTYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQVSLDPMKNVTCENGLPAVVSCVPGQVFSPDGPSRFRKAYKPEQPLVRLRGGAYIGEGRVEVLKNGEWGTVCDDKWDLVSASVVCRELGFGSAKEAVTGSRLGQGIGPIHLNEIQCTGNEKSIIDCKFNAESQGCNHEEDAGVRCNTPAMGLQKKLRLNGGRNPYEGRVEVLVERNGSLVWGMVCGQNWGIVEAMVVCRQLGLGFASNAFQETWYWHGDVNSNKVVMSGVKCSGTELSLAHCRHDGEDVACPQGGVQYGAGVACSETAPDLVLNAEMVQQTTYLEDRPMFMLQCAMEENCLSASAAQTDPTTGYRRLLRFSSQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLEDTECEGDIQKNYECANFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSPQ mint 9DF5D25D4824BCCD snai1_human Zinc finger protein SNAI1 Protein snail homolog 1 SNAI1 SNAH protein protein human Homo sapiens Human MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR DIP protein O95863 original sequence version: 109 DIP protein O95863 original sequence version: 141 70E298C9BB154115 hdac2-1 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ha tag ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association F4B loxl2-hdac2-1 2 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ha tag ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association F4A