IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Discovery of mutations in homologous recombination genes in African-American women with breast cancer. Discovery of mutations in homologous recombination genes in African-American women with breast cancer. Familial cancer 2018 imex curation Ding YC., Adamson AW., Steele L., Bailis AM., John EM., Tomlinson G., Neuhausen SL. Cancer - Interactions investigated in the context of cancer sneuhausen@coh.org 21-Nov-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ding YC., Adamson AW., Steele L., Bailis AM., John EM., Tomlinson G., Neuhausen SL. Cancer - Interactions investigated in the context of cancer sneuhausen@coh.org Accepted 2019-OCT-11 AT 17:04 BST AT 17:04 BST by MGT Familial cancer 2018 Only protein-protein interactions imex curation imex curation ra51b_human DNA repair protein RAD51 homolog 2 RAD51L1 RAD51B REC2 RAD51 homolog B RAD51-like protein 1 protein protein human Homo sapiens Human MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIF DIP protein O15315 original sequence version: 118 DB0B9AE82F44A52B ra51c_human DNA repair protein RAD51 homolog 3 RAD51 homolog C RAD51C RAD51L2 RAD51-like protein 2 protein protein human Homo sapiens Human MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQLCMQLAVDVQIPECFGGVAGEAVFIDTEGSFMVDRVVDLATACIQHLQLIAEKHKGEEHRKALEDFTLDNILSHIYYFRCRDYTELLAQVYLLPDFLSEHSKVRLVIVDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMTTKIDRNQALLVPALGESWGHAATIRLIFHWDRKQRLATLYKSPSQKECTVLFQIKPQGFRDTVVTSACSLQTEGSLSTRKRSRDPEEEL DIP protein O43502 original sequence version: 118 3AAADD3C1C0851E0 xrcc3_human DNA repair protein XRCC3 XRCC3 X-ray repair cross-complementing protein 3 protein protein human Homo sapiens Human MDLDLLDLNPRIIAAIKKAKLKSVKEVLHFSGPDLKRLTNLSSPEVWHLLRTASLHLRGSSILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDVPGELLQKLRFGSQIFIEHVADVDTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDSQASAPRARHLQSLGATLRELSSAFQSPVLCINQVTEAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADRLREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH DIP protein O43542 original sequence version: 119 4DDF3B163C3B3332 ra51d_human DNA repair protein RAD51 homolog 4 R51H3 RAD51-like protein 3 TRAD RAD51D RAD51L3 RAD51 homolog D protein protein human Homo sapiens Human MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGADLYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCMAANVAHGLQQNVLYVDSNGGLTASRLLQLLQAKTQDEEEQAEALRRIQVVHAFDIFQMLDVLQELRGTVAQQVTGSSGTVKVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHITRDRDSGRLKPALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSRQPTGFQEMVDIGTWGTSEQSATLQGDQT DIP protein O75771 original sequence version: 130 6038DA9356DF354A rad54_human DNA repair and recombination protein RAD54-like RAD54L RAD54A RAD54 homolog protein protein human Homo sapiens Human MRRSLAPSQLAKRKPEGRSCDDEDWQPGLVTPRKRKSSSETQIQECFLSPFRKPLSQLTNQPPCLDSSQHEAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEKDALVLYEPPPLSAHDQLKLDKEKLPVHVVVDPILSKVLRPHQREGVKFLWECVTSRRIPGSHGCIMADEMGLGKTLQCITLMWTLLRQSPECKPEIDKAVVVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGARVSSPILIISYETFRLHVGVLQKGSVGLVICDEGHRLKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAHEFKKHFELPILKGRDAAASEADRQLGEERLRELTSIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQTELYKRFLRQAKPAEELLEGKMSVSSLSSITSLKKLCNHPALIYDKCVEEEDGFVGALDLFPPGYSSKALEPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFNSPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSAGTIEEKIFQRQSHKKALSSCVVDEEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQRGLR DIP protein Q92698 original sequence version: 82 718100974CA6687B rad51_human DNA repair protein RAD51 homolog 1 RAD51 RAD51A RECA RAD51 homolog A protein protein human Homo sapiens Human MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD DIP protein Q06609 original sequence version: 154 DIP protein Q06609 original sequence version: 145 DIP protein Q06609 original sequence version: 122 DIP protein Q06609 original sequence version: 121 DIP protein Q06609 original sequence version: 125 DIP protein Q06609 original sequence version: 123 DIP protein Q06609 original sequence version: 144 DIP protein Q06609 original sequence version: 167 DIP protein Q06609 original sequence version: 169 26578E6206DEDEDA xrcc2_human DNA repair protein XRCC2 XRCC2 X-ray repair cross-complementing protein 2 protein protein human Homo sapiens Human MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLEVEVLFIDTDYHFDMLRLVTILEHRLSQSSEEIIKYCLGRFFLVYCSSSTHLLLTLYSLESMFCSHPSLCLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFATTQTIMQKASSSSEEPSHASRRLCDVDIDYRPYLCKAWQQLVKHRMFFSKQDDSQSSNQFSLVSRCLKSNSLKKHFFIIGESGVEFC DIP protein O43543 original sequence version: 105 5656277E74C06074 rad51b-rad51c-3 1 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell O43502:p.Cys135Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C R Tue Jun 30 19:09:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys135Arg' 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association Table 2, Table 4S rad51c-xrcc3-2 1 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell O43542:p.Leu297Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L P Tue Jun 30 18:27:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu297Pro' O43542:p.Val337Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V E Tue Jun 30 17:47:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val337Glu' physical association physical association Table 2, Table 4S rad51-rad51-8 1 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q06609:p.Ala79Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain A D Tue Jun 30 16:13:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala79Asp' Q06609:p.Ala55Val mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain A V Tue Jun 30 19:04:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala55Val' 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association Table 2, Table 4S rad51-rad51-13 1 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q06609:p.Ala55Val mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain A V Tue Jun 30 18:21:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala55Val' Q06609:p.Ala79Asp mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain A D Tue Jun 30 20:02:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala79Asp' 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association Table 2, Table 4S rad54l-rad51-1 1 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q06609:p.Ala55Val mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain A V Tue Jun 30 18:07:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala55Val' Q06609:p.Ala79Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain A D Tue Jun 30 17:59:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala79Asp' physical association physical association Table 2, Table 4S rad51-xrcc3-1 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell O43542:p.Leu297Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L P Tue Jun 30 16:57:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu297Pro' O43542:p.Val337Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V E Tue Jun 30 20:25:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val337Glu' 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association Table 2, Table 4S rad51d-xrcc2-19 1 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell O75771:p.Ala34Val mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain A V Tue Jun 30 16:25:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala34Val' physical association physical association Table 2, Table 4S xrcc2-rad51d-9 1 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell O75771:p.Ala34Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain A V Tue Jun 30 18:30:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala34Val' physical association physical association Table 2, Table 4S rad51d-xrcc2-20 1 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell O43543:p.Phe270Val mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F V Tue Jun 30 17:27:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe270Val' physical association physical association Table 2, Table 4S rad51d-xrcc2-21 1 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell O43543:p.Phe270Val mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F V Tue Jun 30 17:28:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe270Val' physical association physical association Table 2, Table 4S rad51c-rad51b-5 1 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell O43502:p.Cys135Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C R Tue Jun 30 19:07:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys135Arg' 2 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association Table 2, Table 4S rad51c-xrcc3-4 1 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell O43502:p.Cys135Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C R Tue Jun 30 19:47:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys135Arg' 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association Table 2, Table 4S rad51-xrcc3-2 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q06609:p.Ala55Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain A V Tue Jun 30 17:13:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala55Val' Q06609:p.Ala79Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain A D Tue Jun 30 16:58:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala79Asp' physical association physical association Table 2, Table 4S